LOADING...
   NP_809137.1;SP16700A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809137.1    SP16700A            JCSG 417788 PDB Deposition 14-OCT-27              PDB id: 2mw1

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_809137.1
DESCRIPTIONgi|29345634|ref|NP_809137.1| hypothetical protein BT0224 [Bacteroides thetaiotao
micron VPI-5482]
ORGANISMBACTEROIDES THETAIOTAOMICRON VPI-5482
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MW1; Identical; 12-NOV-14; LIPOCALIN-LIKE PROTEIN;
DR FFAS; 409158; Fold and function assignment.
DR TVPC; NP_809137.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_809137.1; Ortholog view popup.
DR TPM; NP_809137.1; Target PDB monitor.
DR FSS; NP_809137.1; Target function coverage.
PROPERTY Residues: 134 aa
Molecule Weight: 14965.33 Dalton
Isoelectric Point: 5.3
Extinction Coefficient: 20970
Gravy Index: -.34
Number of Met residues: 4
Percentage of Met residues: 2.99 %
Number of Cys residues: 4
Percentage of Cys residues: 2.99 %
SEQUENCE  amino acids 134 aa
>NP_809137.1  gi|29345634|ref|NP_809137.1| hypothetical protein BT0224 [Bacteroides thetaiotaomicron VPI-5482]
MKKLLLCLMVGVMSLTSCELSDPDGLADPMKWSKVPSGLKNGELKVEAEGGSSLFACKNY
KSFWISSVKEEGKFKENTSYKEFDGGWYLVKIEDNELKVIINRNETNASRSFTVCVEAGN
AFDEFKFVQDAAKQ

CDS  cDNA 405 bp
   1 atgaagaaac tattgttatg cttgatggta ggcgtaatgt cccttacaag ctgcgaattg    60
  61 tccgaccctg atggacttgc cgaccctatg aagtggagca aggttccgtc gggcttgaag   120
 121 aacggcgaac tgaaagtgga agccgaagga ggaagcagcc tgtttgcctg caaaaactac   180
 181 aaaagttttt ggattagtag cgtgaaggaa gaaggaaaat tcaaggaaaa cacttcatac   240
 241 aaagagtttg acggaggctg gtatctcgtc aagatagagg acaacgaact aaaggttatt   300
 301 atcaatcgca acgaaacgaa cgcatcacgt tccttcacgg tttgcgtgga agcaggaaat   360
 361 gccttcgacg aattcaagtt cgtacaagat gcagcaaaac aataa   405
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
244852 245256 -1 Glimmer3 score 6.7 poor
Genemark probabilities .77   .06 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu