LOADING...
   NP_722245.1;SP17422O
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_722245.1    SP17422O            JCSG 417498 PDB Deposition 14-APR-17              PDB id: 4q5t

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_722245.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMStreptococcus mutans
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF03180; Lipoprotein_9;
DR PDB; 4Q5T; Identical; 18-JUN-14; LIPOPROTEIN;
DR PDB; 1P99; Highly similar; 20-JAN-04; HYPOTHETICAL PROTEIN PG110;
DR PDB; 4QHQ; Highly similar; 18-JUN-14; LIPOPROTEIN;
DR PDB; 4K3F; Highly similar; 24-APR-13; PROBABLE TONB-DEPENDENT RECEPTOR;
DR PDB; 4IB2; Highly similar; 16-JAN-13; PUTATIVE LIPOPROTEIN;
DR PDB; 1XS5; Highly similar; 23-NOV-04; MEMBRANE LIPOPROTEIN TPN32;
DR PDB; 4YAH; Highly similar; 08-APR-15; D-METHIONINE-BINDING LIPOPROTEIN METQ;
DR PDB; 3TQW; Highly similar; 21-SEP-11; METHIONINE-BINDING PROTEIN;
DR FFAS; 413740; Fold and function assignment.
DR TVPC; NP_722245.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_722245.1; Ortholog view popup.
DR TPM; NP_722245.1; Target PDB monitor.
DR FSS; NP_722245.1; Target function coverage.
PROPERTY Residues: 280 aa
Molecule Weight: 31018.02 Dalton
Isoelectric Point: 9.46
Extinction Coefficient: 39420
Gravy Index: -.47
Number of Met residues: 3
Percentage of Met residues: 1.07 %
Number of Cys residues: 1
Percentage of Cys residues: 0.36 %
SEQUENCE  amino acids 280 aa
>NP_722245.1  gi|24380290|ref|NP_722245.1| putative membrane lipoprotein [Streptococcus mutans UA159]
MKLKKILGLLGLALAAAFVLTACGQKNDKNTLTVGVMTMTDSDKERWDKIEELLKKENIK
LKFKEFTDYSQPNKALKNGEIDINSFQHYNFLNNWNKENKGDLVTVAETYISPINLFSGT
ENGKAKYSSAKEIPNGGQIAIPNDATNESRALYVLQDAGLIKLNVSGDELATVKNIKSNP
KNLDIKEVDASQTARNLASVDAAVVNNSYAVPAKIDFKTSLYKEKVNEGSKQWINIIAAQ
KNWKKSKKAAAIKKLIKAYHTDAVKKVIKKTAKGVDEPVW

CDS  cDNA 843 bp
   1 atgaaactta aaaaaatatt aggtctttta ggattggctt tagctgcggc atttgtttta    60
  61 acggcttgcg gtcaaaaaaa tgataaaaat acgttaactg ttggtgtgat gaccatgact   120
 121 gattctgata aagaacgttg ggataaaatt gaggaactgc ttaaaaaaga aaatatcaaa   180
 181 cttaaattta aagagtttac agattattca cagccgaata aagctttaaa aaacggtgaa   240
 241 attgacatca attctttcca gcattataat ttcttgaata attggaacaa ggaaaacaag   300
 301 ggtgatttag ttactgtagc tgagacatat atcagtccga ttaatctttt ctcaggcaca   360
 361 gaaaatggta aagcaaaata cagtagtgct aaggaaattc caaatggtgg tcaaattgct   420
 421 attcctaatg atgctactaa cgaaagccgc gctctttacg ttcttcaaga tgctggctta   480
 481 attaaattaa atgtttctgg tgatgaattg gctaccgtta aaaatattaa gtcaaatccc   540
 541 aaaaatcttg atattaaaga agtagatgct agtcaaacag ctcgtaattt agcatccgtt   600
 601 gatgctgctg ttgttaataa cagttacgct gttccagcaa aaattgattt caaaacttct   660
 661 ctttataaag aaaaagtgaa cgaaggctct aaacaatgga ttaatatcat tgcagctcaa   720
 721 aagaattgga aaaaatcaaa gaaggcagca gcgattaaga aattgattaa ggcttatcat   780
 781 acagatgctg ttaaaaaagt tattaaaaag actgccaaag gcgttgatga acctgtttgg   840
 841 taa   843
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1819890 1820732 -3 Glimmer3 score 12.15 good
Genemark probabilities .9   .79 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu