LOADING...
   NP_639274.1;MG14655B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_639274.1    MG14655B            JCSG 391540 PDB Deposition 09-FEB-12              PDB id: 3g8z

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_639274.1
DESCRIPTIONProtein of unknown function with cystatin-like fold.
ORGANISMXanthomonas campestris
COMMENT 
DR UNIPROT; Q8P3Y3_XANCP
DR SPTR; Q8P3Y3 (flat text); Q8P3Y3 (good view)
DR GenBank; NP_639274
DR PDB; 3G8Z; Identical; 24-FEB-09; PROTEIN OF UNKNOWN FUNCTION WITH CYSTATIN-LIKE FO CHAIN: A;
DR FFAS; 391540; Fold and function assignment.
DR TVPC; NP_639274.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_639274.1; Ortholog view popup.
DR TPM; NP_639274.1; Target PDB monitor.
DR FSS; NP_639274.1; Target function coverage.
PROPERTY Residues: 129 aa
Molecule Weight: 13983.05 Dalton
Isoelectric Point: 4.95
Extinction Coefficient: 19480
Gravy Index: -.08
Number of Met residues: 6
Percentage of Met residues: 4.65 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 129 aa
>NP_639274.1  gi|21233357|ref|NP_639274.1| hypothetical protein XCC3934 [Xanthomonas campestris pv. campestris str
MNTIDIAKSYITAIQTGDHATLGSIISPDVIWHQPGNHQFSGTHRGMAVVGPMLGKMMEV
SNGTFAISRADDYMASGDWVAITLEFSGQANGVTLKQAGVDLLRIEDGKIVEVRLFSADQ
TQEDAFWGR

CDS  cDNA 390 bp
   1 atgaacacca tcgacatcgc caagtcctac atcaccgcaa tccagaccgg tgaccacgca    60
  61 acgctgggca gcatcatttc gcccgacgtg atctggcacc agccgggtaa ccatcagttc   120
 121 tccggcaccc accgcggcat ggctgtcgtc gggccgatgt tgggcaagat gatggaggtc   180
 181 tccaacggca ccttcgccat cagccgtgca gacgactaca tggccagtgg cgactgggtg   240
 241 gccatcaccc tggaattttc cggccaggcc aacggcgtca cgctcaagca agcgggcgtg   300
 301 gacctgctgc gcatcgaaga cggcaagatc gtcgaagtcc ggctgttctc ggccgatcaa   360
 361 acccaggaag atgccttctg gggacgctga   390
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4663326 4663715 3 Glimmer3 score 16.68 good
Genemark probabilities .9   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu