LOADING...
   NP_639225.1;FP4107A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_639225.1    FP4107A            JCSG 383078 PDB Deposition 09-NOV-23              PDB id: 3ksr

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_639225.1
DESCRIPTIONSerine hydrolase (alpha/beta hydrolase) [DPP6 catalytic domain-like] with a conserved catalytic triad (S108/D186/H217)
ORGANISMXanthomonas campestris
COMMENT 
DR UNIPROT; Q8P431_XANCP
DR SPTR; Q8P431 (flat text); Q8P431 (good view)
DR GenBank; NP_639225
DR PDB; 3KSR; Identical; 22-DEC-09; PUTATIVE SERINE HYDROLASE;
DR KEGG; 3.4.-.-; Enzyme page
DR FFAS; 383078; Fold and function assignment.
DR TVPC; NP_639225.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_639225.1; Ortholog view popup.
DR TPM; NP_639225.1; Target PDB monitor.
DR FSS; NP_639225.1; Target function coverage.
PROPERTY Residues: 289 aa
Molecule Weight: 31599.21 Dalton
Isoelectric Point: 6.14
Extinction Coefficient: 36900
Gravy Index: -.18
Number of Met residues: 7
Percentage of Met residues: 2.42 %
Number of Cys residues: 3
Percentage of Cys residues: 1.04 %
SEQUENCE  amino acids 289 aa
>NP_639225.1  gi|21233308|ref|NP_639225.1| hydrolase or peptidase [Xanthomonas campestris pv. campestris str. ATCC
MEAKLSSIEIPVGQDELSGTLLTPTGMPGVLFVHGWGGSQHHSLVRAREAVGLGCICMTF
DLRGHEGYASMRQSVTRAQNLDDIKAAYDQLASLPYVDAHSIAVVGLSYGGYLSALLTRE
RPVEWLALRSPALYKDAHWDQPKVSLNADPDLMDYRRRALAPGDNLALAACAQYKGDVLL
VEAENDVIVPHPVMRNYADAFTNARSLTSRVIAGADHALSVKEHQQEYTRALIDWLTEMV
VGRRIALAKEVVAARKQLLKEQQGDAVSLPGQGSREFRGDIRAVEKTSA

CDS  cDNA 870 bp
   1 atggaagcca aactatccag catcgaaatc cccgttggcc aggatgaact cagtggcacc    60
  61 ttgctcacgc ccaccggcat gccgggcgtg ttgttcgtgc acgggtgggg tggcagccag   120
 121 catcacagcc tggtgcgcgc gcgcgaagcc gtgggcctgg gctgcatctg catgaccttc   180
 181 gatctacgcg gccacgaagg ctatgcctcg atgcgccaga gcgtgacgcg tgcgcagaac   240
 241 ctggacgata tcaaggccgc ctacgatcag ctggcaagcc tgccgtatgt ggatgcgcat   300
 301 tcgattgcgg tggtgggctt gagctatggg gggtatctct cggccttgct cacgcgcgag   360
 361 cgcccggtgg aatggctggc gctgcgctcg cctgcgctct acaaggatgc gcattgggat   420
 421 cagccgaaag tgagcctgaa tgccgacccg gacttgatgg actatcgccg gcgtgcgctt   480
 481 gcgcccggcg acaatctggc gcttgccgcg tgcgcgcaat acaagggcga cgtgttgctg   540
 541 gtggaggccg agaacgatgt gatcgtgccg catccggtga tgcgcaacta tgcagatgcc   600
 601 ttcaccaatg cgcgctcgct gacctcgcgt gtcattgccg gtgccgatca tgcgttgagc   660
 661 gtgaaagagc atcagcagga atacacccgt gcattgatcg attggctgac cgagatggtg   720
 721 gtggggcgtc gcatcgcact ggccaaggaa gtggtggccg cacgcaagca gttgctcaag   780
 781 gaacagcagg gcgatgcggt gtcgttgccg gggcagggtt cgcgcgaatt tcgtggcgat   840
 841 attcgtgcgg tggaaaagac gtcggcataa   870
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4615565 4616434 -2 Glimmer3 score 15.68 good
Genemark probabilities .92   .43 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu