LOADING...
   NP_639141.1;FK5749A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_639141.1    FK5749A            JCSG 371319 PDB Deposition 07-APR-17              PDB id: 2pke

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_639141.1
DESCRIPTIONhaloacid delahogenase-like family hydrolase
ORGANISMXanthomonas campestris
COMMENT 
DR UNIPROT; Q8P4B4_XANCP
DR SPTR;
DR GenBank; NP_639141
DR Pfam; PF00702; Hydrolase;
DR PDB; 2PKE; Identical; 08-MAY-07; HALOACID DELAHOGENASE-LIKE FAMILY HYDROLASE;
DR PDB; 3DDH; Highly similar; 30-SEP-08; PUTATIVE HALOACID DEHALOGENASE-LIKE FAMILY HYDROL CHAIN: A,;
DR FFAS; 371319; Fold and function assignment.
DR TVPC; NP_639141.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_639141.1; Ortholog view popup.
DR TPM; NP_639141.1; Target PDB monitor.
DR FSS; NP_639141.1; Target function coverage.
PROPERTY Residues: 250 aa
Molecule Weight: 27718.75 Dalton
Isoelectric Point: 4.69
Extinction Coefficient: 33920
Gravy Index: -.21
Number of Met residues: 5
Percentage of Met residues: 2.00 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 250 aa
>NP_639141.1  gi|21233224|ref|NP_639141.1| hydrolase, haloacid delahogenase-like family [Xanthomonas campestris pv
MTPIAQRDGQAIQLVGFDGDDTLWKSEDYYRTAEADFEAILSGYLDLGDSRMQQHLLAVE
RRNLKIFGYGAKGMTLSMIETAIELTEARIEARDIQRIVEIGRATLQHPVEVIAGVREAV
AAIAADYAVVLITKGDLFHQEQKIEQSGLSDLFPRIEVVSEKDPQTYARVLSEFDLPAER
FVMIGNSLRSDVEPVLAIGGWGIYTPYAVTWAHEQDHGVAADEPRLREVPDPSGWPAAVR
ALDAQAGRQQ

CDS  cDNA 753 bp
   1 atgactccca ttgcacagcg cgacggccag gcgatccaac tggtcggctt cgacggcgac    60
  61 gacaccctct ggaagagcga ggattactac cgcacggccg aagcggactt cgaggccatc   120
 121 ctgtccggct atctggacct gggcgacagc cgcatgcagc agcatctgct ggcagtagag   180
 181 cggcgcaatc tcaagatctt cggctacggt gccaagggca tgaccttgtc gatgatcgaa   240
 241 accgcgatcg agctaaccga ggcgcgcatc gaggcacgcg acatccagcg catcgtcgag   300
 301 attggccgcg ccacgctgca acacccggtg gaggtcattg ccggcgtgcg cgaggcggtg   360
 361 gctgcaatcg ccgccgacta cgcggtggtg ttgatcacca agggcgacct gttccatcag   420
 421 gagcagaaga tcgaacagtc gggcttgagc gatctgtttc cgcgcatcga ggtggtgtcc   480
 481 gagaaggatc cgcagaccta tgcgcgcgtg cttagcgaat tcgatctgcc tgcggagcgc   540
 541 tttgtgatga tcggcaattc gctgcgttcg gatgtcgagc cggtgctggc gatcggtggc   600
 601 tggggcatct acacaccgta tgcggtgacc tgggcacacg agcaggacca tggcgtggca   660
 661 gcggatgagc cgcgcctgcg cgaagtgccg gacccatccg gttggccggc cgccgtgcgc   720
 721 gcgctggatg cgcaggcggg gcgccagcag taa   753
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4516069 4516821 -1 Glimmer3 score 17.12 good
Genemark probabilities .89   .93 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu