LOADING...
   NP_638301.1;FK8795C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_638301.1    FK8795C            JCSG 371737 PDB Deposition 07-FEB-26              PDB id: 2ozh

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_638301.1
DESCRIPTIONAcetyltransferase [Acyl-CoA N-acyltransferases]
ORGANISMXanthomonas campestris
COMMENT 
DR UNIPROT; Q8P6L4_XANCP
DR SPTR;
DR GenBank; NP_638301
DR Pfam; PF00583; Acetyltransf_1;
DR PDB; 2OZH; Identical; 20-MAR-07; HYPOTHETICAL PROTEIN XCC2953;
DR KEGG; 2.; Enzyme page
DR FFAS; 371737; Fold and function assignment.
DR TVPC; NP_638301.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_638301.1; Ortholog view popup.
DR TPM; NP_638301.1; Target PDB monitor.
DR FSS; NP_638301.1; Target function coverage.
PROPERTY Residues: 141 aa
Molecule Weight: 15711.06 Dalton
Isoelectric Point: 6.35
Extinction Coefficient: 15930
Gravy Index: 0
Number of Met residues: 4
Percentage of Met residues: 2.84 %
Number of Cys residues: 1
Percentage of Cys residues: 0.71 %
SEQUENCE  amino acids 141 aa
>NP_638301.1  gi|21232384|ref|NP_638301.1| hypothetical protein XCC2953 [Xanthomonas campestris pv. campestris str
MPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFAR
VISDYATFAYLGDVFVLPEHRGRGYSKALMDAVMAHPDLQGLRRFSLATSDAHGLYARYG
FTPPLFPQSLMERYVPGLYST

CDS  cDNA 426 bp
   1 atgccgcacg tgcacgtcag caccgacaac tccctgctcg atatcggctt gatccatcgc    60
  61 acgctgtcac aagacaccga ttgggccaag gacattcccc tcgcccttgt gcagcgcgcg   120
 121 atcgatcatt cgttgtgctt cggcgggttt gtcgatggcc ggcaagtcgc gttcgccagg   180
 181 gtgatttccg actatgcgac ctttgcgtac ctgggcgatg tgttcgtgct gccggagcac   240
 241 cgcggccgcg gctacagcaa ggcgctgatg gatgcggtca tggcgcatcc cgatctgcag   300
 301 gggctacgcc gcttcagcct ggccaccagt gatgcgcatg gcctgtacgc ccgctacggg   360
 361 tttacgccgc cattgtttcc gcagtcgttg atggagcggt atgttcctgg gttgtattcg   420
 421 acctag   426
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3514134 3514559 -3 Glimmer3 score 11.4 poor
Genemark probabilities .68   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu