LOADING...
   NP_637619.1;FG7482A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_637619.1    FG7482A            JCSG 380344 PDB Deposition 08-JUN-30              PDB id: 3dmb

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_637619.1
DESCRIPTIONPutative General Stress Protein 26 with a PNP-Oxidase like fold
ORGANISMXanthomonas campestris
COMMENTThis protein shares sequence similarity to the cl00381: Pyridoxamine 5'-phosphate oxidase superfamily from CDD which contains COG3871: Uncharacterized stress protein (general stress protein 26) (E-value: 5e-18).

Structurally, it is similar to proteins from the PNP-oxidase like family from SCOP, including 2qea, 2fhq, 2hq7, 2i02, and 2re7.
DR UNIPROT; Q8P8H7_XANCP
DR SPTR;
DR GenBank; NP_637619
DR PDB; 3U34; Identical; 27-JUN-12; GENERAL STRESS PROTEIN;
DR PDB; 3U35; Identical; 27-JUN-12; GENERAL STRESS PROTEIN;
DR PDB; 3DMB; Identical; 26-AUG-08; PUTATIVE GENERAL STRESS PROTEIN 26 WITH A PNP-OXI FOLD;
DR PDB; 2QEA; Highly similar; 10-JUL-07; PUTATIVE GENERAL STRESS PROTEIN 26;
DR FFAS; 367066; Fold and function assignment.
DR TVPC; NP_637619.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_637619.1; Ortholog view popup.
DR TPM; NP_637619.1; Target PDB monitor.
DR FSS; NP_637619.1; Target function coverage.
PROPERTY Residues: 162 aa
Molecule Weight: 17748.21 Dalton
Isoelectric Point: 5.32
Extinction Coefficient: 31970
Gravy Index: -.29
Number of Met residues: 4
Percentage of Met residues: 2.47 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 162 aa
>NP_637619.1  gi|21231702|ref|NP_637619.1| general stress protein [Xanthomonas campestris pv. campestris str. ATCC
MADPKELQDKFWKALKSDRTVMLGLDGVEDGHARPMTAQIEGDSGGPIWFFTSKDNALIA
MLGQGRRVIGAFSSKGHDLFASISGSLREDTDPAVVDRLWNPYVAAWYEGGKDDPKLALL
RLDADHAQIWLNGSSLLAGIKVLLGVDPKKDYQDKVADVPLR

CDS  cDNA 489 bp
   1 atggcagatc ccaaagaact gcaagacaaa ttctggaaag ccctcaagtc cgatcgcacc    60
  61 gtgatgctcg gcctggatgg cgtcgaagac ggccatgcgc gcccgatgac cgcgcagatc   120
 121 gaaggcgaca gtggtggccc gatctggttc tttacttcca aggacaatgc cttgatcgcg   180
 181 atgctgggcc agggccgccg cgtgatcggt gcgttcagca gcaaggggca tgacctgttc   240
 241 gccagcatca gtggttcgct gcgcgaagac accgacccgg ccgtggtcga tcgcctgtgg   300
 301 aacccgtacg tcgcagcctg gtacgaaggc ggcaaggacg atccgaagct ggcgctgctg   360
 361 cgcctggacg ccgatcacgc gcagatctgg ctcaacggct ccagcctgct ggccggtatc   420
 421 aaggtgctgc tcggcgtgga cccgaagaag gactaccagg acaaggtggc agacgtcccg   480
 481 ctgcgctga   489
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2663562 2664050 -3 Glimmer3 score 17.77 good
Genemark probabilities .88   .07 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu