LOADING...
   NP_636912.1;PG9920A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_636912.1    PG9920A            JCSG 372467 PDB Deposition 07-JUL-09              PDB id: 2qjw

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_636912.1
DESCRIPTIONPutative hydrolase of the alpha/beta superfamily [Atu1826-like].
ORGANISMXanthomonas campestris
COMMENT 
DR UNIPROT; Q8PAE4_XANCP
DR SPTR;
DR GenBank; NP_636912
DR PDB; 2QJW; Identical; 24-JUL-07; UNCHARACTERIZED PROTEIN XCC1541;
DR KEGG; 3.; Enzyme page
DR FFAS; 372467; Fold and function assignment.
DR TVPC; NP_636912.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_636912.1; Ortholog view popup.
DR TPM; NP_636912.1; Target PDB monitor.
DR FSS; NP_636912.1; Target function coverage.
PROPERTY Residues: 175 aa
Molecule Weight: 18712.45 Dalton
Isoelectric Point: 6.37
Extinction Coefficient: 17990
Gravy Index: .16
Number of Met residues: 3
Percentage of Met residues: 1.71 %
Number of Cys residues: 1
Percentage of Cys residues: 0.57 %
SEQUENCE  amino acids 175 aa
>NP_636912.1  gi|21230995|ref|NP_636912.1| hypothetical protein XCC1541 [Xanthomonas campestris pv. campestris str
MSRGHCILAHGFESGPDALKVTALAEVAERLGWTHERPDFTDLDARRDLGQLGDVRGRLQ
RLLEIARAATEKGPVVLAGSSLGSYIAAQVSLQVPTRALFLMVPPTKMGPLPALDAAAVP
ISIVHAWHDELIPAADVIAWAQARSARLLLVDDGHRLGAHVQAASRAFAELLQSL

CDS  cDNA 528 bp
   1 atgagtcgcg gccattgcat cctggcgcat ggattcgaaa gcgggcccga tgcgctcaag    60
  61 gtcaccgcgc tggcagaagt ggccgagcgc ctgggatgga cgcatgagcg gcccgatttc   120
 121 accgacctgg acgcacgccg cgacctgggt cagctgggcg atgtgcgcgg ccggttgcag   180
 181 cgtttgctgg agattgcacg tgccgccacc gagaaaggcc cggtggtgct ggcgggctcc   240
 241 agtctgggct cctacatcgc cgcgcaggtc tcgctgcagg tgccgacacg cgcgctgttc   300
 301 ctgatggtgc cgccgaccaa gatggggccg ctgccggcgc tggatgccgc tgcggtgccg   360
 361 atctccatcg tgcatgcctg gcacgatgaa ctgattccgg ccgccgacgt cattgcctgg   420
 421 gcgcaggccc gttcggcgcg gctgctgttg gtcgatgacg ggcatcgcct gggtgcgcat   480
 481 gtgcaggccg cttcgcgcgc cttcgccgaa ctgctgcaga gcctgtga   528
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1800982 1801509 1 Glimmer3 score 14.81 good
Genemark probabilities .85   .14 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu