LOADING...
   NP_636471.1;FG7480A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_636471.1    FG7480A            JCSG 367064 PDB Deposition 09-APR-21              PDB id: 3h50

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_636471.1
DESCRIPTIONA zinc-binding protein from cupin superfamily involved in tetracenomycin polyketide synthesis
ORGANISMXanthomonas campestris
COMMENT 
DR UNIPROT; Q8PBM3_XANCP
DR SPTR;
DR GenBank; NP_636471
DR Pfam; PF07883; Cupin_2;
DR PDB; 2GU9; Identical; 07-NOV-06; TETRACENOMYCIN POLYKETIDE SYNTHESIS PROTEIN;
DR PDB; 3H50; Identical; 05-MAY-09; TETRACENOMYCIN POLYKETIDE SYNTHESIS PROTEIN;
DR FFAS; 367064; Fold and function assignment.
DR TVPC; NP_636471.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_636471.1; Ortholog view popup.
DR TPM; NP_636471.1; Target PDB monitor.
DR FSS; NP_636471.1; Target function coverage.
PROPERTY Residues: 113 aa
Molecule Weight: 12165.88 Dalton
Isoelectric Point: 4.85
Extinction Coefficient: 9970
Gravy Index: -.39
Number of Met residues: 2
Percentage of Met residues: 1.77 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 113 aa
>NP_636471.1  gi|21230554|ref|NP_636471.1| tetracenomycin polyketide synthesis protein [Xanthomonas campestris pv.
MQYATLELNNAFKVLFSLRQVQAAEMVIAPGDREGGPDNRHRGADQWLFVVDGAGEAIVD
GHTQALQAGSLIAIERGQAHEIRNTGDTPLKTVNFYHPPAYDAQGEPLPAGEG

CDS  cDNA 342 bp
   1 atgcagtacg caacgttgga attgaacaac gcattcaagg tgctgttttc gctgcgccag    60
  61 gtgcaggcgg cagaaatggt gattgcaccg ggtgatcgcg aaggtggccc ggacaatcgc   120
 121 catcgcggcg ccgatcaatg gctgttcgtg gtggacggcg caggcgaggc catcgtggat   180
 181 ggtcacacgc aggccttgca ggccggcagt ctgatcgcga tcgagcgtgg ccaggcgcac   240
 241 gagattcgca ataccggcga cacgccgctg aagacggtca acttctatca cccgccggcc   300
 301 tacgatgcgc agggcgaacc attgccggca ggcgaaggct ga   342
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1274078 1274419 2 Glimmer3 score 16.63 good
Genemark probabilities .79   .67 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu