LOADING...
   NP_636218.1;PX11702A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_636218.1    PX11702A            JCSG 396520 PDB Deposition 09-APR-21              PDB id: 3h51

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_636218.1
DESCRIPTIONPutative calcium/calmodulin dependent protein kinase II association domain
ORGANISMXanthomonas campestris
COMMENT-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
DR UNIPROT; Q8PCA7_XANCP
DR SPTR; Q8PCA7 (flat text); Q8PCA7 (good view)
DR GenBank; NP_636218
DR Pfam; PF08332; CaMKII_AD;
DR PDB; 3H51; Identical; 05-MAY-09; PUTATIVE CALCIUM/CALMODULIN DEPENDENT PROTEIN KIN ASSOCIATIO;
DR FFAS; 395996; Fold and function assignment.
DR TVPC; NP_636218.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_636218.1; Ortholog view popup.
DR TPM; NP_636218.1; Target PDB monitor.
DR FSS; NP_636218.1; Target function coverage.
PROPERTY Residues: 174 aa
Molecule Weight: 19030.6 Dalton
Isoelectric Point: 6.91
Extinction Coefficient: 21430
Gravy Index: -.2
Number of Met residues: 4
Percentage of Met residues: 2.30 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 174 aa
>NP_636218.1  gi|21230301|ref|NP_636218.1| hypothetical protein XCC0827 [Xanthomonas campestris pv. campestris str
MRRPLFSLVLALAATPALAGGVMHYTDKAALPADGEAREVAALFDTWNAALATGNPHKVA
DLYAPDGVLLPTVSNEVRASREQIENYFEMFLTKKPKGVINYRTVRLLDDDSAVDAGVYT
FTLTDKNGKKSDVQARYTFVYEKRDGKWLIINHHSSAMPEVDTATATAAVTKAK

CDS  cDNA 525 bp
   1 atgcgtcgcc ccctgttctc tctggttctg gctctggctg ccaccccggc gctggctggc    60
  61 ggcgtgatgc attacaccga caaggccgcg ctgcccgccg atggcgaagc gcgcgaagtg   120
 121 gctgcgctgt tcgacacctg gaacgcggcc ctggccaccg gcaacccgca caaggtggcc   180
 181 gacctgtacg ccccggacgg cgtgctgctg ccgacggttt ccaacgaagt gcgcgcctcg   240
 241 cgcgagcaga tcgaaaacta cttcgagatg ttcctgacca aaaagccgaa gggcgtcatc   300
 301 aactaccgca ccgtgcgcct gctcgatgac gacagcgcgg tggatgcggg tgtgtacacc   360
 361 ttcacgctca ccgacaagaa cggcaagaag agcgatgtgc aggcccgcta caccttcgtg   420
 421 tacgaaaagc gcgacggcaa gtggctgatc atcaaccacc acagctcggc catgccggaa   480
 481 gtggataccg ccaccgccac cgctgcggtc accaaggcga agtga   525
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
985081 985605 1 Glimmer3 score 20.69 good
Genemark probabilities .84   .01 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu