LOADING...
   NP_635776.1;MG14561F
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_635776.1    MG14561F            JCSG 391539 PDB Deposition 09-JUN-25              PDB id: 3i0y

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_635776.1
DESCRIPTIONPutative polyketide cyclase from Xanthomonas campestris [Cystatin-like]
ORGANISMXanthomonas campestris
COMMENT 
DR UNIPROT; Q8PDF7_XANCP
DR SPTR; Q8PDF7 (flat text); Q8PDF7 (good view)
DR GenBank; NP_635776
DR PDB; 3I0Y; Identical; 21-JUL-09; PUTATIVE POLYKETIDE CYCLASE;
DR PDB; 3F7X; Highly similar; 25-NOV-08; PUTATIVE POLYKETIDE CYCLASE;
DR PDB; 3F8H; Highly similar; 25-NOV-08; PUTATIVE POLYKETIDE CYCLASE;
DR KEGG; 5.-.-.-; Enzyme page
DR FFAS; 391539; Fold and function assignment.
DR TVPC; NP_635776.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_635776.1; Ortholog view popup.
DR TPM; NP_635776.1; Target PDB monitor.
DR FSS; NP_635776.1; Target function coverage.
PROPERTY Residues: 139 aa
Molecule Weight: 15698.45 Dalton
Isoelectric Point: 4.72
Extinction Coefficient: 22920
Gravy Index: -.52
Number of Met residues: 3
Percentage of Met residues: 2.16 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 139 aa
>NP_635776.1  gi|21229859|ref|NP_635776.1| hypothetical protein XCC0381 [Xanthomonas campestris pv. campestris str
MSESNRQRATGLVQAYYEAFNRGDWDAMLAFLAEDVAHDLNQGPREIGRAAFASFLQRMN
DSYREQLRDIVVTANDEGTRVGAEYVVHGVYHTTDEGLPDANGQTYVLPGGAFFDVRDGQ
ITRVTNYYNLQEWIAQVSR

CDS  cDNA 420 bp
   1 atgagcgaga gcaatcggca acgcgccacc ggcctggtcc aggcctacta cgaggcattc    60
  61 aaccgcggcg attgggacgc catgctggcg ttcctggccg aggacgtcgc ccacgacctc   120
 121 aaccagggtc cacgcgagat cggccgggcg gccttcgcca gcttcctgca gcgcatgaat   180
 181 gacagctacc gcgagcagct gcgcgacatc gtggtgactg ccaatgacga aggcacgcgc   240
 241 gtcggcgccg agtacgtggt gcatggcgtc taccacacca ccgacgaagg cctgccggac   300
 301 gcgaacgggc agacctatgt gctgcccggc ggcgcgttct tcgatgtgcg cgatgggcag   360
 361 atcacgcggg tgaccaatta ctacaacctg caggaatgga ttgcgcaggt gtcgcgctga   420
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
455024 455443 2 Glimmer3 score 17.52 good
Genemark probabilities .88   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu