LOADING...
   NP_463836.1;MJ14477B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_463836.1    MJ14477B            JCSG 403100 PDB Deposition 10-NOV-08              PDB id: 3pj0

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_463836.1
DESCRIPTIONPutative L-allo-threonine aldolase
ORGANISMListeria monocytogenes egd-e
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF01212; Beta_elim_lyase;
DR PDB; 3PJ0; Identical; 24-NOV-10; LMO0305 PROTEIN;
DR PDB; 3LWS; Highly similar; 31-MAR-10; AROMATIC AMINO ACID BETA-ELIMINATING LYASE/THREONINE ALDOLAS;
DR KEGG; 4.1.2.-; Enzyme page
DR FFAS; 403100; Fold and function assignment.
DR TVPC; NP_463836.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_463836.1; Ortholog view popup.
DR TPM; NP_463836.1; Target PDB monitor.
DR FSS; NP_463836.1; Target function coverage.
PROPERTY Residues: 358 aa
Molecule Weight: 39896.18 Dalton
Isoelectric Point: 4.89
Extinction Coefficient: 40340
Gravy Index: -.18
Number of Met residues: 4
Percentage of Met residues: 1.12 %
Number of Cys residues: 5
Percentage of Cys residues: 1.40 %
SEQUENCE  amino acids 358 aa
>NP_463836.1  gi|16802351|ref|NP_463836.1| similar to low specificity L-allo-threonine aldolase [Listeria monocyto
MTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDIYGNGAVIEDFETKIAKIL
GKQSAVFFPSGTMAQQIALRIWADRKENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGT
ANQLLTIDDIKSLREPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARL
WEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLIS
LYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVYFENSAD
EIGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL

CDS  cDNA 1077 bp
   1 atgacaaaca cactaaaaac cagttaccaa aaaacacctt ataaactagg cgggaatggc    60
  61 ccgcgcaatg tgggtgtttt aacagaagca cttcaaaata tagatgataa tttagaaagc   120
 121 gatatttacg gaaacggtgc agttattgaa gactttgaaa caaaaatcgc gaaaattctc   180
 181 gggaaacaat ctgcggtatt tttcccaagt gggacgatgg cacaacaaat cgcgttaagg   240
 241 atttgggctg accggaaaga gaatcggcgc gtagcatatc atccgctctc tcatttggag   300
 301 attcatgagc aagatgggct aaaagaattg cagcaaatca cgccactatt acttggtaca   360
 361 gcgaatcagc ttttgacaat tgacgatatt aaaagtcttc gcgagccagt ttctagtgtg   420
 421 cttatcgaac ttcctcaacg agaaattggt gggcaactac ctgcttttga agagcttgag   480
 481 aagatttcag agtattgcca tgaacagggt atttcgttgc atctggacgg ggcgcggtta   540
 541 tgggaaatta cgccgtttta tcagaagtct gcggaagaaa tttgtgcgct gtttgatagt   600
 601 gtgtatgtgt cgttttataa agggattggc gggattgctg gggcgatttt ggctgggaat   660
 661 gatgattttg tgcaagaggc gaaaatctgg aaacgacggt atggcgggga tttgattagt   720
 721 ctgtatccat atattttgtc cgcggattat tattttgaaa aacggattgg gaaaatggcg   780
 781 gagtattttg aagcggcgaa aggattggct gagcgattta attcgtgttc gggcgtgaag   840
 841 actgtgccgg aagtgccggt ttctaatatg tttcatgttt attttgagaa ttcggctgat   900
 901 gagattgggg caattttgac gaagattcag gatgaaactg gcgttgggat ttcggggtat   960
 961 ttgcaggaga aatcagcgga tgtttgtgcg tttgaggttt cggttgggga tgcgtttgcg  1020
1021 gaaataccag caaaaaattt agaactagtt tttagatgtt tggaaaagga actttga  1077
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
329923 330999 1 Glimmer3 score 6.49 poor
Genemark probabilities .88   .18 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu