LOADING...
   NP_436101.1;CP20730C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_436101.1    CP20730C            JCSG 423098 PDB Deposition 13-SEP-27              PDB id: 4myr

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_436101.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMSinorhizobium meliloti 1021
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07811; TadE;
DR PDB; 4MYR; Identical; 16-OCT-13; CPAE2 PILUS ASSEMBLY PROTEIN;
DR FFAS; 423097; Fold and function assignment.
DR TVPC; NP_436101.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_436101.1; Ortholog view popup.
DR TPM; NP_436101.1; Target PDB monitor.
DR FSS; NP_436101.1; Target function coverage.
PROPERTY Residues: 586 aa
Molecule Weight: 62754.12 Dalton
Isoelectric Point: 8.31
Extinction Coefficient: 29910
Gravy Index: .03
Number of Met residues: 14
Percentage of Met residues: 2.39 %
Number of Cys residues: 7
Percentage of Cys residues: 1.19 %
SEQUENCE  amino acids 586 aa
>NP_436101.1  gi|16263308|ref|NP_436101.1| probable CpaE2 pilus assembly protein [Sinorhizobium meliloti 1021]
MEIPNMKQLDSETREAPQPMTAAPLLPIPKVDIAVFCQSEEVREAVGTAAIDRRMARATV
TVKAGGMKEATALYGGVTSPNLVVVESDDGEARLMATLETLAMECVTGTKVIVIGRSNDV
GLYKKLLDAGVSDYLVKPLEPMDFVAAVHRCFRDSTEEKLGRIVAFVGAKGGTGSSTLAH
NVAYAMSKRVDADVLLADLDLQSGTLGLNFDIEAKHGMVDVLQSPDRLDDVLLRRLAVSY
TDRLHLLPATTDLDKFINLREGDVDHLLDVARSSSWHVVVDLPHILTQWTRKILLEADEI
VVTATPDLAGMRNAKNLIDFLKKARPNDPPPRLVLNKVGTPKLQEIKPKDFVAAVGLEEG
VSLAFEPSLFGAAANNGRLVIESAPDSKAGKAIVSLAWRVGGTRERRTRQKGVKALLQKV
FKRGKPKAPSTLRKKAGELKTSEAGASAVEFALVAPVLALGLVATADLGLAIHERMTIDH
VLRAGAQAALADPGAAQVQKVLVSTLAESPRLASAVLPAVKRYCACPENADVAPEAAPQC
GTVTCANAKPQFVYYRLAAAKSYRPMSLPAVLPVFELGSSMQVQVQ

CDS  cDNA 1761 bp
   1 atggaaattc cgaacatgaa acagctcgat agcgaaacca gggaagcacc gcagccgatg    60
  61 accgctgcac cgctgttgcc cataccgaag gtggacatcg ccgtcttctg ccagtcggaa   120
 121 gaggtgagag aggccgtcgg cacggcggcg atcgatcgtc gcatggcgcg cgccaccgta   180
 181 acggtgaagg ccggaggaat gaaagaggcg actgcgcttt atggcggcgt aacatcgccg   240
 241 aacctcgtcg tcgtagagag cgacgatggc gaggcccgtc tgatggccac cttggaaacg   300
 301 ctcgcaatgg agtgtgtcac ggggaccaag gtcatcgtca tcggccgctc caacgatgtg   360
 361 ggtctctaca agaagcttct ggacgccggt gtgagcgact atctcgtcaa gccgctcgag   420
 421 ccgatggact tcgtcgcggc ggtgcaccgc tgcttccgcg actctaccga ggaaaagctg   480
 481 gggcgcatcg tcgcattcgt cggtgccaag ggaggaaccg gctcctccac gctcgcgcac   540
 541 aacgtggcat acgccatgtc caagcgggtg gatgccgatg ttcttctggc ggatcttgat   600
 601 cttcagtccg gtacgctcgg actgaacttc gacatcgagg cgaaacacgg catggtggat   660
 661 gtgctccaga gccccgatcg tctcgacgac gtgctgctgc gacgcctggc ggtcagctac   720
 721 acggaccgcc tgcacctgct tccggcgacc acggatctcg acaagttcat taatcttcgg   780
 781 gagggcgatg tcgatcatct cctcgacgtc gctcgttcga gctcgtggca tgtcgtcgtc   840
 841 gatctgccgc acattctgac gcagtggacg aggaagatcc tgctagaggc ggacgaaatc   900
 901 gtcgtgacgg cgacgcccga cctggccggc atgcgcaatg ccaagaacct gatcgatttc   960
 961 ctgaagaagg cgcggccgaa cgatccgccg ccgcgccttg tgctcaacaa ggttggcacc  1020
1021 ccgaaacttc aggagatcaa gccgaaggat ttcgtggcgg ctgtcggcct ggaagagggc  1080
1081 gtctctctgg cgttcgagcc gtccttgttc ggcgcggcgg ccaataatgg ccggctggtc  1140
1141 atcgagtcgg caccggattc gaaggcggga aaagccatag tttcgctcgc ctggcgggtt  1200
1201 ggcgggacgc gggagagacg gacgcggcag aaaggggtca aagctttgct gcagaaggtc  1260
1261 ttcaaacgcg gcaagccgaa ggctccgtcc acgttgcgca agaaggccgg ggaattgaag  1320
1321 acgtccgagg ccggtgcttc ggcggtcgaa ttcgcgctag tcgcgccggt cctcgctctc  1380
1381 ggtctcgtgg ctacggccga tctcggtctt gcgatccatg agcggatgac gatcgaccat  1440
1441 gtcctgcgcg ccggcgcgca ggccgctctg gccgatcccg gcgcggcgca ggtccaaaag  1500
1501 gtgctcgttt ccaccttggc cgagagcccg cgtctggcga gtgccgtgct gccggcagtg  1560
1561 aagcgctact gcgcctgccc ggaaaatgcc gatgtcgcac ctgaagccgc gccgcaatgc  1620
1621 ggaacggtga cctgcgcgaa cgcgaaaccg caattcgtgt attatcggct cgcggctgca  1680
1681 aagtcctatc ggcccatgtc cctgccggcg gtacttcccg tgttcgagct cgggtcctcc  1740
1741 atgcaggtgc aagtccaatg a  1761
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu