LOADING...
   NP_422544.1;C.LS20770A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_422544.1    C.LS20770A            JCSG 423816 PDB Deposition 13-MAY-24              PDB id: 4kwy

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_422544.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMCaulobacter crescentus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4KWY; Identical; 19-JUN-13; PUTATIVE UNCHARACTERIZED PROTEIN;
DR FFAS; 423816; Fold and function assignment.
DR TVPC; NP_422544.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_422544.1; Ortholog view popup.
DR TPM; NP_422544.1; Target PDB monitor.
DR FSS; NP_422544.1; Target function coverage.
PROPERTY Residues: 166 aa
Molecule Weight: 17912.19 Dalton
Isoelectric Point: 8.73
Extinction Coefficient: 19940
Gravy Index: -.25
Number of Met residues: 2
Percentage of Met residues: 1.20 %
Number of Cys residues: 1
Percentage of Cys residues: 0.60 %
SEQUENCE  amino acids 166 aa
>NP_422544.1  gi|16127980|ref|NP_422544.1| hypothetical protein [Caulobacter crescentus CB15]
MKRTLAAAVLAFSTITLTACAGFTPLYGRAGVESGLSSIETVAAEGRGGYLLREQLDDAL
AHRQGSPAAYKLYLSVNEQRFARGVRLDNVANRFELRMSVDWRLLDAKNGAEVHKGRTDV
SVTYDSADQPYAAIAAQQDGQERAAAEAARKIQLDLATWLAGKKPA

CDS  cDNA 501 bp
   1 atgaagcgca ccctggcggc cgccgtcctg gccttttcga cgatcacgct cacggcatgc    60
  61 gcgggtttca cgcccctgta cggccgtgcg ggggtggaga gcggcctctc gagcatcgag   120
 121 accgtcgccg ccgaggggcg tggcggctac ctgcttcgcg agcagctcga cgacgccttg   180
 181 gcccatcgcc aaggctcgcc cgccgcctac aagctctatc tgtcggtcaa cgaacagcgc   240
 241 ttcgcccggg gcgtccgcct cgacaacgtc gccaaccgct ttgaactgcg gatgagcgtc   300
 301 gactggcggc ttctggacgc caagaacggg gccgaggtcc acaaggggcg gaccgacgtc   360
 361 tcggtgacct acgattccgc cgaccagccc tacgccgcca tcgccgcgca gcaggatggt   420
 421 caagaacgcg ccgccgcaga ggccgcgcgc aagattcagc tggacctcgc cacctggctg   480
 481 gcgggcaaga agccggcctg a   501
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4002771 4003271 3 Glimmer3 score 14.99 good
Genemark probabilities .75   .88 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu