LOADING...
   NP_422278.1;NP_422278.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_422278.1    CC0400A            JCSG 424729 PDB Deposition 14-APR-04              PDB id: 4q20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_422278.1
DESCRIPTIONTyrosine kinase DivL, signal transduction, two-component regulatory system, HisKA domain, GHKL domain
ORGANISMCaulobacter crescentus
COMMENTTwo domain protein, the first one is HisKA domain (His Kinase A (phospho-acceptor), PF00512) or two-component regulatory system; second
one is GHKL domain - HATPase_c (PF02518): Histidine kinase, DNA gyrase B, and HSP90-like ATPase.
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF02518; HATPase_c;
DR Pfam; PF00512; HisKA;
DR PDB; 4Q20; Identical; 23-APR-14; SENSOR PROTEIN DIVL;
DR FFAS; 423687; Fold and function assignment.
DR TVPC; NP_422278.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_422278.1; Ortholog view popup.
DR TPM; NP_422278.1; Target PDB monitor.
DR FSS; NP_422278.1; Target function coverage.
PROPERTY Residues: 769 aa
Molecule Weight: 82791.69 Dalton
Isoelectric Point: 5.14
Extinction Coefficient: 86400
Gravy Index: -.11
Number of Met residues: 6
Percentage of Met residues: 0.78 %
Number of Cys residues: 8
Percentage of Cys residues: 1.04 %
SEQUENCE  amino acids 769 aa
>NP_422278.1  gi|16127714|ref|NP_422278.1| tyrosine kinase DivL [Caulobacter crescentus CB15]
MTSYDLILAAAAGAVCLAISVALWSHGQRRNLEARIVALKTRLIQQGGSDDAPAWLDAFD
TAVIAVEGGRANLVAGGEGLIACAKALGADAEVSAVVAALSDADPNYAQKLTALFERGEP
CVFEARGPHGLVSVEGRAAGALAWLRLAPIDRADSGLPTAARFAAFVDSVVEPCWIAGAD
GQAIWGNAAFVRAVGAASAQAPALAGKSFDRGADAVVVEAAGKGERREALRWINVEGRRR
AFRLSAQPLDGGGVGVFCADVTEIEDVRDAFKKHVEAHDETLNHIAEAVAIFSQTRRLSY
HNTAFAELWGLEPAWLADRPTHGEVLDRLRQRRRLPETIDYAGWKAAELARYEDLGPQAD
DLWDLPDGRTLKVVRQPHPLGGMLLIYSDITGELRLKAQYNALIQVQQATLDKLNDAVAV
FGSDGRLRLHNEAFETFWNVTPHALEAAGDFEGVVELCVPRLHDLSFWRELKGRVADPDP
QMRAPTSGEVRTSDSRIVLYQSRPLPDGATLIAFADVTDTRDLQSALADRSAALAEAERL
KRDFVGNVSYELRTPLTTIIGYSELLERADGISERGRNHVAAVRAAATQLARSIDDVLDM
AQIDAGEMALEIEDIRVSDLLLNAQERALKDAQLGGVTLAVECEEDVGLIRGDGKRLAQT
LDHLVENALRQTPPGGRVTLSARRALGEVRLDVSDTGRGVPFHVQAHIFDRFVGRDRGGP
GLGLALVKALVELHGGWVALESEPGNGSTFTCHLPETQQPGAMQPELGF

CDS  cDNA 2310 bp
   1 atgacttcgt acgacctgat cctcgcggcg gcggccggcg cggtatgtct cgccatttcc    60
  61 gtcgccctgt ggtcccacgg gcagcgacgg aacctggagg cgcgtatcgt cgcgctcaag   120
 121 acgcgcctga tccagcaggg cggctcggac gacgccccgg cctggctcga cgccttcgac   180
 181 accgccgtga tcgccgtcga gggcggccgc gcaaacctgg tcgccggcgg cgaaggcctg   240
 241 atcgcctgcg ccaaggcgct gggggcggac gccgaggtct cggccgtggt cgctgcgctc   300
 301 agcgacgccg atccgaacta cgcccagaag ctgaccgccc tgttcgagcg tggcgagcct   360
 361 tgcgtgttcg aagcgcgcgg tccccatggc cttgtttcgg tcgagggtcg cgcggcgggc   420
 421 gccctggcct ggctgcgcct ggcgccgatc gaccgcgccg actcgggcct gcccaccgcc   480
 481 gcccgcttcg ccgccttcgt cgacagcgtg gtcgagccgt gctggatcgc cggcgccgat   540
 541 ggccaggcga tctggggcaa cgccgccttt gtgcgcgccg tgggcgcggc ctccgcccag   600
 601 gccccggccc tggcgggcaa gagctttgat cgcggcgccg acgccgtggt cgtcgaagcc   660
 661 gccggcaagg gcgaacgtcg cgaagcgctg cgctggatca atgtcgaggg ccgccgccgg   720
 721 gcgttccgac tgtcggccca gccgctggat ggcggcgggg tgggcgtgtt ctgcgccgac   780
 781 gtcaccgaga tcgaggatgt ccgcgacgcc ttcaagaagc acgtcgaggc gcacgacgag   840
 841 accctgaacc acatcgccga ggccgtggcg atcttcagcc agacgcgccg cctgtcgtac   900
 901 cacaacaccg ccttcgccga gctgtggggc ctggagccgg cctggctggc cgaccgtccg   960
 961 acgcatggcg aggtgctgga ccgcctgcgc cagcgtcgcc gcctgcccga gaccatcgac  1020
1021 tacgccggct ggaaggccgc cgaactggcc cgttacgaag accttggccc gcaggccgac  1080
1081 gacctgtggg acctgcccga cggccgcacc ctgaaggtcg tccgtcagcc gcacccgctg  1140
1141 ggcggcatgc tgctgatcta ttccgacatc accggcgagc tgcgcctgaa agcccagtac  1200
1201 aacgccctga tccaggtgca gcaggccacg ctggacaagc tgaacgacgc cgtcgccgtg  1260
1261 ttcggctcgg acggtcgcct gcggctgcat aacgaggcct tcgagacgtt ctggaacgtc  1320
1321 accccgcacg ccctggaggc ggccggagac ttcgagggcg tggtcgagct gtgcgtgccg  1380
1381 cgtctgcacg acctgtcgtt ctggcgcgag ctcaaaggcc gggtcgccga tccggatccg  1440
1441 cagatgcgcg ctccgacctc gggcgaggtg cgaacctccg acagccgcat cgtgctgtac  1500
1501 cagagccggc cgctgccgga cggcgcgacc ctgatcgcct tcgccgacgt caccgacacc  1560
1561 cgagacctgc agagcgccct ggccgatcgc tcggcggccc tggccgaagc cgagcgcctg  1620
1621 aagcgcgact tcgtcggcaa tgtctcctac gagctgcgca cgccgctgac gacgatcatc  1680
1681 ggctattcgg agctgctgga gcgggccgac ggcatctccg agcggggccg caaccacgtg  1740
1741 gccgccgtcc gcgccgccgc cacccagctg gcgcgctcga tcgacgacgt gctggacatg  1800
1801 gcccagatcg acgccggcga aatggcgctg gagatcgagg acatccgcgt ctcagacctg  1860
1861 ctgctgaacg cccaggagcg cgccctgaag gacgcacagc tgggcggcgt caccctggcc  1920
1921 gtcgagtgcg aggaggacgt cggcctgatc cggggtgacg gcaagcgcct ggcccagacg  1980
1981 ctggaccatc tggtggaaaa cgccctgcgc cagaccccgc cgggcggccg cgtcaccctg  2040
2041 tcggcccgcc gggctctggg cgaggtgcgg ctggacgtct ccgacaccgg gcggggcgtg  2100
2101 ccgttccatg tgcaggccca catcttcgac cgcttcgtcg gccgcgatcg cggcggcccg  2160
2161 ggcctgggcc tggccctggt caaggcgctg gtcgaactgc acggcggctg ggtggcgctg  2220
2221 gagagcgaac cgggcaacgg ttcgaccttc acctgccacc tgcccgagac ccaacaaccc  2280
2281 ggggccatgc agcccgaact cggcttctag  2310
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3724305 3726614 3 Glimmer3 score 18.27 good
Genemark probabilities .96   .4 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu