LOADING...
   NP_421737.1;CC20730A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_421737.1    CC20730A            JCSG 423095 PDB Deposition 13-OCT-02              PDB id: 4n0p

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_421737.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMCaulobacter crescentus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4N0P; Identical; 27-NOV-13; PILUS ASSEMBLY PROTEIN CPAE;
DR FFAS; 423094; Fold and function assignment.
DR TVPC; NP_421737.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_421737.1; Ortholog view popup.
DR TPM; NP_421737.1; Target PDB monitor.
DR FSS; NP_421737.1; Target function coverage.
PROPERTY Residues: 517 aa
Molecule Weight: 55114.25 Dalton
Isoelectric Point: 4.85
Extinction Coefficient: 35410
Gravy Index: -.18
Number of Met residues: 12
Percentage of Met residues: 2.32 %
Number of Cys residues: 3
Percentage of Cys residues: 0.58 %
SEQUENCE  amino acids 517 aa
>NP_421737.1  gi|16127173|ref|NP_421737.1| pilus assembly protein CpaE [Caulobacter crescentus CB15]
MRPTDNDPFDLGFDAADEFTTGAGDPWRSSAPSLTPAGGFEDPFADFPPARPREDGAPPA
RSSQVAPPTTRPTPQARPVQPAAPAAAAPDYDEGERDTPASAPVASAPAYDEPIADSGMG
DAVIPRITIHAFCARPETAALIEKAAADRRMSRAATIVRDGGLEAAVDYYQNQPTPSLVM
VETLDGAQRLLHLLDSLAQVCDPGTKVVVVGQTNDIALYRELMRRGVSEYLTQPLGPLQV
IRAVGALYADPAAPFTGRQIAFVGAKGGVGASTLAHNFAWSMAEKMQSATVLVDLDLAFG
TAGLDFNQDPLQGVLDALSQPDRLDPVLMDRMMVRCADRLSLFAAPASLDDDYEFGADAF
EEVTQKIRGAAPFVVLDLPHVWNAWSRRVLIGSDDLVVVATPDLASLRNAKNIIDLVKGS
RPNDAPPRLVLNQVGVPGRPEIPVKDFGEALGVQPSLVLPFDPKPYGQAANNGQMLAEVA
PKSKAAEGLEHLARLISRREPPPVQKTSMFSGLFKKK

CDS  cDNA 1554 bp
   1 atgcggccga ccgacaacga tcccttcgac ctgggcttcg acgccgccga cgagttcacg    60
  61 accggcgcgg gcgacccctg gcgctcatcc gccccgtcgc tgacgccggc gggcgggttc   120
 121 gaggacccgt tcgccgactt cccgccggcc cggccccgcg aggacggagc cccgccggcc   180
 181 cgctcgtcgc aggtcgcgcc gccgaccacc cggcccacgc cccaggcgcg cccggtccag   240
 241 cccgccgcgc cggcggcggc cgcacccgac tatgacgagg gcgaacgcga cacccccgcc   300
 301 agcgcgcccg tcgcgtcagc cccggcctat gacgagccga tcgccgacag cgggatgggc   360
 361 gatgcggtga tcccgcgcat caccatccac gcgttctgcg cccggcccga gaccgccgcc   420
 421 ctgatcgaaa aggccgccgc cgaccgtcgc atgtcgcgcg ccgccaccat cgtgcgcgac   480
 481 ggcgggctgg aagcggccgt cgactactac cagaaccagc cgacgccctc gctggtcatg   540
 541 gtcgaaaccc tggacggcgc ccagcgcctg ctgcacctgc tcgacagcct ggcccaggtc   600
 601 tgcgacccgg gcaccaaggt ggtcgtcgtg ggccagacca acgacatcgc cctctatcgc   660
 661 gagctgatgc gtcggggcgt cagcgagtat ctgacccagc cgctgggccc gttgcaggtg   720
 721 atccgcgccg tcggggcgct gtacgccgat ccggccgcgc cgttcaccgg ccgccagatc   780
 781 gccttcgtcg gcgccaaggg cggggtgggg gcctcgaccc tggcccacaa cttcgcctgg   840
 841 tccatggccg agaagatgca gtcggccacc gtgctggtcg acctggatct ggccttcggc   900
 901 accgccggcc tcgacttcaa ccaggacccg ctgcaaggcg tgctggacgc cctgagccag   960
 961 cctgaccgcc tggatccggt gctgatggac cggatgatgg tgcgctgcgc cgatcgcctg  1020
1021 tcgctgttcg ccgcgccggc ctcgctggac gacgactacg agttcggcgc cgacgccttc  1080
1081 gaggaagtga cccagaagat ccgcggcgcc gccccgttcg tggtgctgga cctgccgcac  1140
1141 gtctggaacg cctggagccg tcgggtgctg atcggctccg acgatctggt ggtggtggcc  1200
1201 acgcctgatc tggccagctt gcgcaacgcc aagaacatca tcgacctggt caagggctcg  1260
1261 cgccccaacg acgcgccgcc gcgcctcgtc ctgaaccagg tgggcgtgcc cggtcgtccg  1320
1321 gagatcccgg tcaaggattt cggcgaggcg ctgggcgtgc agccctcgct ggtgctgccc  1380
1381 ttcgatccca agccctacgg ccaggcggcc aacaacggtc agatgctggc cgaggtggcg  1440
1441 cccaagtcca aggccgccga ggggctggag cacctggcgc ggctgatcag ccggcgcgag  1500
1501 ccgccgccgg tgcagaagac gtcgatgttc tcgggcctgt tcaagaagaa gtag  1554
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3166853 3168406 -2 Glimmer3 score 18.46 good
Genemark probabilities .93   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu