LOADING...
   NP_419126.1;C.LS20780A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_419126.1    C.LS20780A            JCSG 423832 PDB Deposition 13-NOV-21              PDB id: 2mhe

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_419126.1
DESCRIPTIONNMR structure of DUF4170 family protein, PF13773, ClpS-like fold
ORGANISMCaulobacter crescentus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MHE; Identical; 05-MAR-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 423832; Fold and function assignment.
DR TVPC; NP_419126.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_419126.1; Ortholog view popup.
DR TPM; NP_419126.1; Target PDB monitor.
DR FSS; NP_419126.1; Target function coverage.
PROPERTY Residues: 74 aa
Molecule Weight: 8229.93 Dalton
Isoelectric Point: 6.16
Extinction Coefficient: 9970
Gravy Index: -.33
Number of Met residues: 1
Percentage of Met residues: 1.35 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 74 aa
>NP_419126.1  gi|16124562|ref|NP_419126.1| hypothetical protein [Caulobacter crescentus CB15]
MPDKQLLHIVVGGELKDVAGVEFRDLSKVEFVGAYPSYDEAHKAWKAKAQATVDNAHARY
FIIHAHKLLDPSEG

CDS  cDNA 225 bp
   1 atgcctgaca agcagcttct tcatatcgta gtcggcggcg agcttaagga cgtcgcgggc    60
  61 gtcgaattcc gtgacctctc caaggtcgag ttcgtcggcg cctatccgag ctacgacgag   120
 121 gcccacaagg cctggaaggc caaggcccag gccacggtcg acaacgccca cgcccgctac   180
 181 ttcatcatcc acgcccacaa gctgctggat ccgagcgaag ggtag   225
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
323812 324036 -1 Glimmer3 score 17.53 good
Genemark probabilities .68   .05 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu