LOADING...
   NP_418910.1;NP_418910.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_418910.1    C.LS1184A            JCSG 430429 PDB Deposition 15-MAR-06

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_418910.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMCaulobacter crescentus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00563; EAL;
DR Pfam; PF00990; GGDEF;
DR Pfam; PF03707; MHYT;
DR Pfam; PF00989; PAS;
DR PDB; 4RNH; Highly similar; 19-NOV-14; MOTILITY REGULATOR;
DR PDB; 4RNF; Highly similar; 19-NOV-14; MOTILITY REGULATOR;
DR FFAS; 430429; Fold and function assignment.
DR TVPC; NP_418910.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_418910.1; Ortholog view popup.
DR TPM; NP_418910.1; Target PDB monitor.
DR FSS; NP_418910.1; Target function coverage.
PROPERTY Residues: 809 aa
Molecule Weight: 86874.28 Dalton
Isoelectric Point: 6.08
Extinction Coefficient: 54890
Gravy Index: .19
Number of Met residues: 24
Percentage of Met residues: 2.97 %
Number of Cys residues: 10
Percentage of Cys residues: 1.24 %
SEQUENCE  amino acids 809 aa
>NP_418910.1  gi|16124346|ref|NP_418910.1| sensory box/GGDEF family protein [Caulobacter crescentus CB15]
MTLKERCVFKLLTCLTTQHDLRLVLVASAVCLAGCFTTFRLYSRMRGARGVVRAAWLLLT
GLVAGSSVWATHFIAMVAFTPGLKTGYSPTGTLLSLMIAALFMASGFAVASAQRSTTNDF
AGGVLIGLGVAAMHYMGMSAFVTQGQLVWEHATVGMSAVLGVGGATAALLLAGTARTIRR
QAVGGGMLCLGIVMLHFTGMSAITIVPDASLTVPDQLLSGGMLTLAVGSITSMIILGGLG
AVAIESQTSRSALERIRRLANAAYEGLVVVQSGRINDANAAFCDLVGAPLAELVGRPLFG
EILTFDEADPSREDVRREGRLRPLVGGREIPVEVFSRLMDDGARVETSGLTVLAVRDLRE
RRAAEEKIRYLAEHDGLTGLLNRNSLQMRLAAAIDRVEASGESLAVICIDLDHFKEANDQ
HGHLAGDALLVETARRLQSAVQAPSFAARLGGDEFIVVQIAGGDQPAVAAELAGRLIEML
AAPVPFDGQELAMGSSLGVSLYPDDGRTAEALMANADMALYRAKESGRGVYRFFKREMDD
TIRERRNLARDLRQGIADNELIVHYQPLARAADGEVCGFEALVRWKHPTRGMIPPLDFIP
VAEENGLIEALGDWVLRRACADAAAWEKPLRIAVNLSPIQLHNPALPTLVHEVLITTGLS
PSRLELEITESALFKDYQRALDNLRRLKALGVRIAMDDFGTGFSSLSTLQSFPFDKIKID
KSFVENIHRHDRATAIVRAVLGLGRSLEIPVVAEGVETEEQILFLRGEDCAELQGYAIGR
PAPVDALTMWTTAGDPGAIAPKSKTRRSA

CDS  cDNA 2430 bp
   1 gtgaccctca aggaacgttg cgtgttcaag ttgctgacct gtctgacgac gcagcatgac    60
  61 ctgcggctgg tgcttgtcgc cagcgccgtc tgtctggcgg gttgctttac gaccttccgt   120
 121 ctttactcgc gcatgcgcgg cgctcggggc gtcgtccggg ccgcttggtt gctgctgacc   180
 181 ggcctggtcg cgggatccag cgtctgggcc acccacttca tcgccatggt cgcgttcacg   240
 241 cccgggctca agaccggcta cagcccgaca ggcacgctcc tgtcgctgat gattgcggcg   300
 301 ctgttcatgg ccagtggctt tgcggtcgcg tcggcgcagc gcagcaccac gaacgatttc   360
 361 gcgggcgggg ttttgatcgg gctcggcgtg gccgccatgc actatatggg catgtcggcc   420
 421 ttcgtgaccc aaggccaact ggtgtgggag cacgcgaccg tcggcatgtc ggccgtcctc   480
 481 ggggtcggtg gcgcgactgc ggccctgctg ctggcgggca cggcgcggac gatccgtcgc   540
 541 caggcggtgg gcggcggcat gctgtgcctg ggcatcgtca tgctgcattt caccggcatg   600
 601 tcggcgatca ccatcgtccc agacgcctcg ctgacggtgc ccgaccagct tctgtccggc   660
 661 ggcatgctga ccctggccgt cggctcgatc acgagcatga tcattctggg ggggcttgga   720
 721 gcggtcgcga tcgagtccca aacctcgcgg tcggcgctcg agcgcatccg tcgtctcgcc   780
 781 aacgcggcct atgaaggcct ggtggtggtg cagtcggggc ggatcaacga cgccaacgcc   840
 841 gcattctgcg acctggtggg cgcgccgctc gccgagctgg tcggacgccc gctcttcggc   900
 901 gagatcctga ccttcgatga ggccgacccc agtcgtgaag acgtccgccg cgaggggcgc   960
 961 ctgcgaccct tggtcggcgg acgcgaaatc ccggtcgagg tgttttctcg cctgatggac  1020
1021 gacggggcgc gcgtagaaac ctcgggcctg acggtcttgg ccgtgcggga cctgcgcgag  1080
1081 cgccgagcgg ccgaagagaa aatccgctac ctcgccgagc atgacggcct caccggcctg  1140
1141 ctcaaccgca actcgctgca gatgcgcctg gccgccgcca tcgatcgggt cgaggcgtcc  1200
1201 ggcgagagcc tggcggtcat ctgcatcgat ctggaccact tcaaggaagc caacgaccag  1260
1261 cacggacacc tggcgggcga cgccctgctg gtcgagaccg cgcgccgtct tcaatcggct  1320
1321 gtgcaagctc cgtccttcgc cgcgcgcctg ggcggcgacg agttcatcgt cgtccagatc  1380
1381 gccggcggtg atcagcccgc cgtcgccgcg gagctggcgg ggcgtctgat cgagatgctg  1440
1441 gccgcgccgg tgccgttcga cggtcaggaa ctggccatgg ggtccagcct cggcgtcagc  1500
1501 ctgtatcctg acgatggtcg gactgccgag gccctgatgg ccaatgcgga catggccctc  1560
1561 tatcgggcca aggagagcgg ccgcggcgtc tatcgcttct tcaagcgcga gatggacgac  1620
1621 accatccgtg aacggcgcaa cctggcgcgc gaccttcgcc aaggcatcgc cgacaatgag  1680
1681 ctgatcgttc actaccagcc gctcgcccgg gcggcggatg gcgaggtatg cggcttcgag  1740
1741 gcgctggtcc ggtggaagca cccgacgcga ggcatgatac cgccgctcga cttcattccg  1800
1801 gtggccgagg agaacgggct gatcgaggcg ctgggcgact gggtgctacg tcgcgcctgt  1860
1861 gcggacgccg ccgcctggga gaagccgctg cgtatcgcgg tcaacctttc tccgatccag  1920
1921 ctgcataatc ccgccctgcc cactctggtg cacgaggttc tgatcacgac gggcctgtcg  1980
1981 ccctcgcggc tggagctgga gatcaccgaa agcgcgctgt tcaaggacta tcagcgagcg  2040
2041 ctcgacaacc tccgccggct taaagccctc ggcgtacgga tcgccatgga cgacttcggc  2100
2101 accggcttct cgtcgctatc gacgctgcag tcgttcccgt tcgacaagat caagatcgac  2160
2161 aagagcttcg tcgagaacat tcatcggcat gaccgcgcca ccgccattgt ccgcgcggtg  2220
2221 ctgggcctgg ggcgcagcct ggagatcccg gtcgtcgccg aaggcgtcga gaccgaggag  2280
2281 cagatcctat tcctgcgcgg ggaggactgc gccgaactgc agggctatgc gatcggccgg  2340
2341 cccgcaccgg tcgacgccct gacgatgtgg accacggccg gcgatccggg cgcgatcgcc  2400
2401 ccaaagagca agaccagacg ttccgcctag  2430
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
99466 101895 -1 Glimmer3 score - -
Genemark probabilities .91   .95 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu