LOADING...
   NP_394635.1;FN0547A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_394635.1    FN0547A            JCSG 380082 PDB Deposition 09-AUG-12              PDB id: 3ing

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_394635.1
DESCRIPTIONPutative dehydrogenase
ORGANISMThermoplasma acidophilum
COMMENTThe gene NP_394635.1 from Thermoplasma Acidophilum encodes a protein with 324 residues consisting
of two domains, N-terminal domain (2-118) and C-terminal Domain(119-324). FFAS and SSM suggest
this protein is a structural homolog mainly to homoserine dehydrogenase (PDB ID: 1Q7G, 1EBF) with
conserved residues in the active site. One NAD(P)H from bacteria natural processing is found and modeled
in the conserved active site, consisting of K117, glu201, Asp 207 and Asp 212. One Ca2+ is also
modeled in the structure.
DR UNIPROT; Q9HIZ7_THEAC
DR SPTR; Q9HIZ7 (flat text); Q9HIZ7 (good view)
DR GenBank; NP_394635
DR Pfam; PF03447; NAD_binding_3;
DR PDB; 3ING; Identical; 01-SEP-09; HOMOSERINE DEHYDROGENASE;
DR PDB; 3C8M; Highly similar; 19-FEB-08; HOMOSERINE DEHYDROGENASE;
DR PDB; 3JSA; Highly similar; 22-SEP-09; HOMOSERINE DEHYDROGENASE;
DR KEGG; 1.1.1.3; Enzyme page
DR FFAS; 380082; Fold and function assignment.
DR TVPC; NP_394635.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_394635.1; Ortholog view popup.
DR TPM; NP_394635.1; Target PDB monitor.
DR FSS; NP_394635.1; Target function coverage.
PROPERTY Residues: 324 aa
Molecule Weight: 35603.14 Dalton
Isoelectric Point: 5.44
Extinction Coefficient: 26360
Gravy Index: -.24
Number of Met residues: 9
Percentage of Met residues: 2.78 %
Number of Cys residues: 1
Percentage of Cys residues: 0.31 %
SEQUENCE  amino acids 324 aa
>NP_394635.1  gi|16082189|ref|NP_394635.1| homoserine dehydrogenase related protein [Thermoplasma acidophilum]
MKEIRIILMGTGNVGLNVLRIIDASNRRRSAFSIKVVGVSDSRSYASGRNLDISSIISNK
EKTGRISDRAFSGPEDLMGEAADLLVDCTPASRDGVREYSLYRMAFESGMNVVTANKSGL
ANKWHDIMDSANQNSKYIRYEATVAGGVPLFSVLDYSILPSKVKRFRGIVSSTINYVIRN
MANGRSLRDVVDDAIKKGIAESNPQDDLNGLDAARKSVILVNHIFGTEYTLNDVEYSGVD
ERSYNANDRLVTEVYVDDRRPVAVSRIISLNKDDFLMSIGMDGLGYQIETDSNGTVNVSD
IYDGPYETAGAVVNDILLLSKVQK

CDS  cDNA 975 bp
   1 atgaaggaaa tcagaataat actgatggga acaggaaacg tcggccttaa cgttctcaga    60
  61 ataatagatg cgagcaatcg gagaagatct gcatttagta ttaaggtggt tggagtatca   120
 121 gattctcgaa gctatgcttc tgggagaaat ctggatatct cgagcataat atccaataaa   180
 181 gagaagactg gcagaatatc ggatcgagca ttctccggtc cggaagatct catgggcgaa   240
 241 gctgccgatt tgctcgttga ctgcacccct gcgtcgagag acggtgttcg tgaatattca   300
 301 ctttacagaa tggcgttcga atccggcatg aacgttgtca cggcaaacaa atccgggtta   360
 361 gctaataaat ggcatgatat catggattcc gcaaaccaga attcgaagta tatacggtat   420
 421 gaagctacgg ttgctggtgg tgtgcccctt ttcagtgtcc ttgattactc aatcctgcct   480
 481 tcaaaggtaa agcggttcag gggcatcgtg agctctacga tcaactatgt aatcaggaac   540
 541 atggcaaatg gaagatctct gagggatgtt gttgatgatg caataaaaaa gggcatcgca   600
 601 gaaagcaatc cgcaggatga cctgaatggt ctggatgctg ccagaaagag tgtgatactt   660
 661 gtgaaccata tatttggaac ggaatacaca ctgaacgatg ttgaatattc cggtgttgat   720
 721 gagagatcat acaatgcgaa cgatcgcctt gtcacagagg tgtacgttga tgatcgcagg   780
 781 ccagttgcag tatcgcgcat catctccctg aataaggacg acttcctgat gagcatcggg   840
 841 atggatggtc ttggctatca gattgaaacc gacagcaacg gtactgtgaa cgtaagtgat   900
 901 atatacgatg gcccatatga aacagccggc gcggtggtga acgatatatt acttttatca   960
 961 aaggtgcaga aataa   975
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu