LOADING...
   NP_394501.1;FL11316A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_394501.1    FL11316A            JCSG 376464 PDB Deposition 07-SEP-25              PDB id: 2re2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_394501.1
DESCRIPTIONPutative iron-molybdenum cofactor (FeMo-co) of dinitrogenase
ORGANISMThermoplasma acidophilum
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank; NP_394501
DR Pfam; PF02579; Nitro_FeMo-Co;
DR PDB; 2RE2; Identical; 09-OCT-07; UNCHARACTERIZED PROTEIN TA1041;
DR FFAS; 376464; Fold and function assignment.
DR TVPC; NP_394501.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_394501.1; Ortholog view popup.
DR TPM; NP_394501.1; Target PDB monitor.
DR FSS; NP_394501.1; Target function coverage.
PROPERTY Residues: 117 aa
Molecule Weight: 12492.53 Dalton
Isoelectric Point: 5.8
Extinction Coefficient: 4470
Gravy Index: -.13
Number of Met residues: 4
Percentage of Met residues: 3.42 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 117 aa
>NP_394501.1  gi|16082583|ref|NP_394501.1| Uncharacterized conserved protein [Thermoplasma acidophilum]
MKFAVAVSGDRVNGPGESEEVQIYETDGGNVRLIEKYSNPALNATAARGVFMLKSALDHG
ANALVLSEIGSPGFNFIKNKMDVYIVPEMPVADALKLILEGKVSPATAPTHDHGHHH

CDS  cDNA 354 bp
   1 atgaaattcg cagtagcagt ttcaggagac agggtcaatg gccccggaga gtcagaggaa    60
  61 gttcagatat atgagacgga tggaggaaac gtgagattga tagagaaata cagcaatcca   120
 121 gccctgaatg caacagcggc gcgcggcgta ttcatgctga agtccgccct ggatcatggg   180
 181 gcaaacgctc tggtcttaag cgaaatagga tcacccggct tcaatttcat aaagaataaa   240
 241 atggacgtat acattgtgcc ggaaatgcca gttgctgatg cccttaagct gatactcgaa   300
 301 ggcaaggtca gccctgcaac cgctccgacg cacgatcatg gacaccatca ctga   354
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu