LOADING...
   NP_394403.1;NP_394403.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_394403.1    SB4281A            JCSG 356213 PDB Deposition 05-JUL-12              PDB id: 2a9v

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_394403.1
DESCRIPTIONgi|16082570|ref|NP_394403.1| GMP synthase [Thermoplasma acidophilum]
ORGANISMTHERMOPLASMA ACIDOPHILUM
COMMENT 
DR UNIPROT; GUAAA_THEAC
DR SPTR;
DR GenBank; NP_394403
DR Pfam; PF00117; GATase;
DR PDB; 2A9V; Identical; 02-AUG-05; GMP SYNTHASE;
DR PDB; 1WL8; Highly similar; 16-AUG-05; GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A;
DR PDB; 2D7J; Highly similar; 21-NOV-06; GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A;
DR PDB; 2LXN; Highly similar; 12-JUN-13; GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A;
DR PDB; 3TQI; Highly similar; 28-SEP-11; GMP SYNTHASE [GLUTAMINE-HYDROLYZING];
DR PDB; 2YWB; Highly similar; 23-OCT-07; GMP SYNTHASE [GLUTAMINE-HYDROLYZING];
DR PDB; 2YWC; Highly similar; 23-OCT-07; GMP SYNTHASE [GLUTAMINE-HYDROLYZING];
DR PDB; 2VPI; Highly similar; 11-MAR-08; GMP SYNTHASE;
DR FFAS; 356213; Fold and function assignment.
DR TVPC; NP_394403.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_394403.1; Ortholog view popup.
DR TPM; NP_394403.1; Target PDB monitor.
DR FSS; NP_394403.1; Target function coverage.
PROPERTY Residues: 200 aa
Molecule Weight: 22470.12 Dalton
Isoelectric Point: 5.27
Extinction Coefficient: 26930
Gravy Index: -.3
Number of Met residues: 2
Percentage of Met residues: 1.00 %
Number of Cys residues: 3
Percentage of Cys residues: 1.50 %
SEQUENCE  amino acids 200 aa
>NP_394403.1  gi|16082570|ref|NP_394403.1| GMP synthase [Thermoplasma acidophilum]
MLKIYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSELDGLDGLVLSGGAPNIDEELD
KLGSVGKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVMHSENIFGGLP
SEITVWENHNDEIINLPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIF
RNFIGICASYREIQKENFQH

CDS  cDNA 603 bp
   1 atgttgaaga tatacgttgt tgataacggt ggccagtgga ctcaccgaga atggcgtgtg    60
  61 ctgagagagc tcggtgttga cacgaagatc gttccaaacg atatcgattc aagcgaactt   120
 121 gatggcctgg atggcctcgt attgagcgga ggagctccga atatagacga ggaattggac   180
 181 aagctgggaa gcgtaggaaa atacatagac gatcacaact atccgatcct cggaatatgc   240
 241 gttggagccc agttcatcgc tctccatttc ggagcatccg tcgtaaaggc aaagcatcca   300
 301 gaattcggaa agacgaaggt ttcagttatg catagcgaaa acatattcgg cggccttccg   360
 361 tctgaaataa ccgtttggga gaaccataac gatgaaatca tcaatctgcc ggatgatttc   420
 421 accctggcag cttcttccgc cacgtgtcag gttcagggat tctatcacaa gacgaggcca   480
 481 atatacgcta cacagttcca tccagaggtg gaacacactc agtatggcag agacatcttc   540
 541 aggaacttca tcggcatatg cgcctcttat agggagatcc agaaggaaaa ctttcagcac   600
 601 tga   603
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu