LOADING...
   NP_394282.1;FL10679A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_394282.1    FL10679A            JCSG 376023 PDB Deposition 08-JAN-24              PDB id: 3c26

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_394282.1
DESCRIPTIONputative acetyltransferase
ORGANISMThermoplasma acidophilum
COMMENT 
DR UNIPROT; Q9HJZ0_THEAC
DR SPTR;
DR GenBank; NP_394282
DR Pfam; PF00583; Acetyltransf_1;
DR PDB; 3C26; Identical; 05-FEB-08; PUTATIVE ACETYLTRANSFERASE TA0821;
DR FFAS; 376023; Fold and function assignment.
DR TVPC; NP_394282.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_394282.1; Ortholog view popup.
DR TPM; NP_394282.1; Target PDB monitor.
DR FSS; NP_394282.1; Target function coverage.
PROPERTY Residues: 265 aa
Molecule Weight: 30521.85 Dalton
Isoelectric Point: 5.31
Extinction Coefficient: 61310
Gravy Index: -.35
Number of Met residues: 8
Percentage of Met residues: 3.02 %
Number of Cys residues: 2
Percentage of Cys residues: 0.75 %
SEQUENCE  amino acids 265 aa
>NP_394282.1  gi|16081879|ref|NP_394282.1| conserved hypothetical protein [Thermoplasma acidophilum]
MSADIVFDRGSPSDIDEIKTFTSNTWKVGYYTDLYSKLADTGTMDDYVDKVIERWVNDGS
VYVLRVSGRPVATIHMEKLPDGSVMLGGLRVHPEYRGSRLGMSIMQETIQFLRGKTERLR
SAVYSWNEPSLRLVHRLGFHQVEEYPIYTFQGGSTAVPALKPVNERYAGRWRCFFIDWKY
MCSDDPDIIHEEYSNNLIVDGSTFVYFDIYEGGIDLFVNDSDDASSFIEKYRSMNGRITF
YVRKALANGLPYVPASSLTVWEYRY

CDS  cDNA 798 bp
   1 atgtctgccg atattgtctt cgatcgtggt tctccttcag acatagatga gatcaaaacg    60
  61 ttcacgtcaa acacatggaa agtaggatac tacacggatc tgtacagtaa gcttgcagat   120
 121 accggcacca tggatgatta tgtggataag gtcatagaga gatgggttaa cgatggttcc   180
 181 gtatacgtat tgagggtttc aggccgtccc gttgccacca tacacatgga aaagcttcca   240
 241 gacggatcgg tcatgctcgg tggactgaga gtacatcctg aataccgcgg atcgaggctc   300
 301 ggaatgagca tcatgcagga gacaatacag tttttgagag gaaaaactga aaggctaaga   360
 361 tctgctgttt actcatggaa tgagccttct ctcaggctgg tgcacaggct tggcttccat   420
 421 caggtggaag agtatccaat atacacattc cagggcggtt ccactgcggt gccggcgctg   480
 481 aaaccagtga atgaaagata cgccggaaga tggagatgct tcttcattga ctggaaatac   540
 541 atgtgctcgg atgatccgga cataattcac gaggaatatt cgaacaatct gatagtagat   600
 601 ggcagtacgt tcgtgtactt cgacatttac gagggaggaa tcgatctttt cgtcaatgat   660
 661 tccgatgatg cgtcttcgtt catagaaaaa tataggagca tgaatggccg catcacattc   720
 721 tatgtgagaa aggctctggc gaatggtctg ccgtacgttc cggcatcatc gctgaccgtg   780
 781 tgggagtaca ggtattga   798
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu