LOADING...
   NP_393992.1;FP10738A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_393992.1    FP10738A            JCSG 382454 PDB Deposition 10-SEP-24              PDB id: 3oz2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_393992.1
DESCRIPTIONGeranylgeranyl bacteriochlorophyll reductase-like.
ORGANISMThermoplasma acidophilum
COMMENT 
DR UNIPROT; GGR_THEAC
DR SPTR; Q9HKS9 (flat text); Q9HKS9 (good view)
DR GenBank; NP_393992
DR PDB; 3OZ2; Identical; 27-OCT-10; DIGERANYLGERANYLGLYCEROPHOSPHOLIPID REDUCTASE;
DR FFAS; 382454; Fold and function assignment.
DR TVPC; NP_393992.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_393992.1; Ortholog view popup.
DR TPM; NP_393992.1; Target PDB monitor.
DR FSS; NP_393992.1; Target function coverage.
PROPERTY Residues: 396 aa
Molecule Weight: 43350.77 Dalton
Isoelectric Point: 6.99
Extinction Coefficient: 48360
Gravy Index: -.12
Number of Met residues: 12
Percentage of Met residues: 3.03 %
Number of Cys residues: 1
Percentage of Cys residues: 0.25 %
SEQUENCE  amino acids 396 aa
>NP_393992.1  gi|16082528|ref|NP_393992.1| Predicted geranylgeranyl reductase [Thermoplasma acidophilum]
METYDVLVVGGGPGGSTAARYAAKYGLKTLMIEKRPEIGSPVRCGEGLSKGILNEADIKA
DRSFIANEVKGARIYGPSEKRPIILQSEKAGNEVGYVLERDKFDKHLAALAAKAGADVWV
KSPALGVIKENGKVAGAKIRHNNEIVDVRAKMVIAADGFESEFGRWAGLKSVILARNDII
SALQYRMINVDVDPDYTDFYLGSIAPAGYIWVFPKGEGMANVGIGSSINWIHNRFELKNY
LDRFIENHPGLKKGQDIQLVTGGVSVSKVKMPITMPGLMLVGDAARLIDPITGGGIANAI
VSGMYAAQVTKEAIESNDYSPQMMQKYEKLIKERFERKHLRNWVAKEKLAMLSDDTLDKL
VDIVSEQVLTTISVEAILKAIAEKYPEVVKELEDLI

CDS  cDNA 1191 bp
   1 atggaaacct atgatgttct tgtggttgga ggcggccctg gcggaagtac ggctgccaga    60
  61 tatgctgcca agtatggcct gaaaacactg atgatagaga agagacctga gataggatct   120
 121 cctgtgagat gcggagaggg cctttcaaag gggatactca acgaagcaga tataaaagct   180
 181 gacagatcct tcatagccaa cgaagtgaaa ggtgcaagga tttacggacc atcggagaag   240
 241 aggccaataa ttctgcagag cgagaaggcc ggaaatgaag ttggctatgt tcttgagagg   300
 301 gacaagttcg acaagcatct tgctgccctt gctgccaagg cgggcgcaga tgtgtgggta   360
 361 aagtcgccgg cccttggcgt gataaaagag aacggcaagg tcgctggggc aaagataagg   420
 421 cacaataacg agatagtgga tgtcagggca aagatggtca tagccgcaga cggtttcgag   480
 481 agcgaattcg gaaggtgggc cggcctgaag agcgtgatac tggcaaggaa tgacataata   540
 541 tccgcgcttc agtacaggat gatcaatgtc gatgtggacc ctgactacac cgacttctac   600
 601 ctcggttcga tagcgccggc cggttatata tgggtattcc cgaaggggga aggcatggcc   660
 661 aacgtgggca tagggtcctc cataaactgg atacacaaca ggttcgagct gaagaactac   720
 721 cttgacaggt tcatagagaa ccatcctggt ttgaagaagg gccaggatat acagcttgtt   780
 781 acaggcggcg tttcggtttc taaggtcaag atgcctatca ctatgccggg cctaatgctc   840
 841 gtaggagacg ctgcaaggct catcgatcca atcacgggtg gtggaatagc aaacgccatt   900
 901 gtctctggta tgtacgctgc gcaggttacc aaggaagcaa ttgagagcaa tgattactcg   960
 961 ccgcagatga tgcagaaata cgaaaaactg ataaaggaac gcttcgagag aaagcacctc  1020
1021 aggaactggg tggcgaagga gaaacttgcc atgctatcgg atgatacgct tgacaagctc  1080
1081 gtcgatatag tatctgagca ggtgcttaca accatatctg tcgaggcgat actgaaggcg  1140
1141 atcgctgaaa aataccctga ggtcgtcaag gagctggaag acctcatctg a  1191
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu