LOADING...
   NP_393673.1;FJ8835A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_393673.1    FJ8835A            JCSG 370499 PDB Deposition 07-JAN-23              PDB id: 2onf

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_393673.1
DESCRIPTIONPutative osmotically inducible protein C
ORGANISMThermoplasma acidophilum
COMMENT 
DR UNIPROT; Q9HLN2_THEAC
DR SPTR;
DR GenBank; NP_393673
DR Pfam; PF02566; OsmC;
DR PDB; 2ONF; Identical; 06-FEB-07; HYPOTHETICAL PROTEIN TA0195;
DR FFAS; 370499; Fold and function assignment.
DR TVPC; NP_393673.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_393673.1; Ortholog view popup.
DR TPM; NP_393673.1; Target PDB monitor.
DR FSS; NP_393673.1; Target function coverage.
PROPERTY Residues: 139 aa
Molecule Weight: 16012.35 Dalton
Isoelectric Point: 5.22
Extinction Coefficient: 16960
Gravy Index: -.44
Number of Met residues: 3
Percentage of Met residues: 2.16 %
Number of Cys residues: 2
Percentage of Cys residues: 1.44 %
SEQUENCE  amino acids 139 aa
>NP_393673.1  gi|16081346|ref|NP_393673.1| conserved hypothetical protein [Thermoplasma acidophilum]
MHVYESDVSWIDDRRTEVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLE
FKDRMGINLKSWNSHVTAELGPSPEKGFKFHRIKIHVKIGVNDEDKEKIPRAMQLAEKYC
FISRAIRNNVEEIVDYEFV

CDS  cDNA 420 bp
   1 atgcatgtgt atgaaagtga tgtatcatgg atcgacgaca ggagaacgga ggtttcggtg    60
  61 ggagatcaca ggatcgaggt tgattctcca ccagagtttg gcggtccaga aggccaactt   120
 121 tatcctgaaa cgcttttccc aagcgttctc gcatcctgcc tcctgacgac tttcctggag   180
 181 ttcaaggaca gaatggggat aaacctgaaa agctggaaca gccatgtaac cgctgaactg   240
 241 gggccgtcgc cagagaaggg cttcaaattc catcgtataa aaatacatgt gaagatagga   300
 301 gtgaacgatg aggataagga gaagataccg agagcaatgc agctggccga aaaatactgt   360
 361 ttcatatcga gggcaataag aaataatgtt gaggaaatag tagattacga attcgtgtga   420
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu