LOADING...
   NP_393672.1;FL4049A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_393672.1    FL4049A            JCSG 388819 PDB Deposition 07-NOV-14              PDB id: 3bdi

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_393672.1
DESCRIPTIONPredicted CIB-like hydrolase
ORGANISMThermoplasma acidophilum
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank; NP_393672
DR PDB; 3BDI; Identical; 27-NOV-07; UNCHARACTERIZED PROTEIN TA0194;
DR PDB; 4F0J; Highly similar; 04-JUL-12; PROBABLE HYDROLYTIC ENZYME;
DR FFAS; 376246; Fold and function assignment.
DR TVPC; NP_393672.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_393672.1; Ortholog view popup.
DR TPM; NP_393672.1; Target PDB monitor.
DR FSS; NP_393672.1; Target function coverage.
PROPERTY Residues: 206 aa
Molecule Weight: 23053.26 Dalton
Isoelectric Point: 8.65
Extinction Coefficient: 31400
Gravy Index: -.15
Number of Met residues: 8
Percentage of Met residues: 3.88 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 206 aa
>NP_393672.1  gi|16082497|ref|NP_393672.1| Predicted hydrolase (alpha/beta superfamily) [Thermoplasma acidophilum]
MALQEEFIDVNGTRVFQRKMVTDSNRRSIALFHGYSFTSMDWDKADLFNNYSKIGYNVYA
PDYPGFGRSASSEKYGIDRGDLKHAAEFIRDYLKANGVARSVIMGASMGGGMVIMTTLQY
PDIVDGIIAVAPAWVESLKGDMKKIRQKTLLVWGSKDHVVPIALSKEYASIISGSRLEIV
EGSGHPVYIKKPEEFVRITVDFLRNL

CDS  cDNA 621 bp
   1 atggcattac aagaagaatt cattgatgtg aatggaacca gggtatttca gaggaagatg    60
  61 gtcacagatt cgaacagaag aagcatagcg ctcttccacg gatactcgtt cacctctatg   120
 121 gattgggata aagccgatct gttcaataac tactcgaaga taggctataa cgtctacgct   180
 181 ccagattatc cgggatttgg aaggtcagcc agttctgaaa agtacgggat agataggggc   240
 241 gatcttaaac acgccgctga atttataagg gattacctaa aggcgaacgg cgtggcgaga   300
 301 tcggtcataa tgggggcatc catgggcggt ggaatggtca taatgactac attgcagtac   360
 361 ccggatatag tagacggcat aattgctgtc gcaccggcat gggttgaatc cctgaagggc   420
 421 gatatgaaga aaataagaca gaaaacgtta ctagtatggg gttcaaagga tcacgtggtg   480
 481 cccatcgccc tctctaagga atatgcatca atcatatcag gatcaagact ggaaattgtt   540
 541 gagggatctg gccatccagt atacataaaa aaacctgaag agttcgtgag gataaccgtt   600
 601 gatttcctga gaaatctctg a   621
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu