LOADING...
   NP_389762.1;SP17476A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_389762.1    SP17476A            JCSG 418978 PDB Deposition 14-JUL-23              PDB id: 4qy7

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_389762.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacillus subtilis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2JQO; Identical; 03-JUL-07; HYPOTHETICAL PROTEIN YOBA;
DR PDB; 4QY7; Identical; 20-AUG-14; UNCHARACTERIZED PROTEIN YOBA;
DR FFAS; 406704; Fold and function assignment.
DR TVPC; NP_389762.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_389762.1; Ortholog view popup.
DR TPM; NP_389762.1; Target PDB monitor.
DR FSS; NP_389762.1; Target function coverage.
PROPERTY Residues: 120 aa
Molecule Weight: 13536.03 Dalton
Isoelectric Point: 6.58
Extinction Coefficient: 9970
Gravy Index: -.29
Number of Met residues: 4
Percentage of Met residues: 3.33 %
Number of Cys residues: 1
Percentage of Cys residues: 0.83 %
SEQUENCE  amino acids 120 aa
>NP_389762.1  gi|16078941|ref|NP_389762.1| yobA [Bacillus subtilis]
MPKIGVSLIVLIMLIIFLAGCNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKE
DYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL

CDS  cDNA 363 bp
   1 atgcctaaaa tcggagtaag cttgatagtg ctcattatgc tcattatttt ccttgcaggc    60
  61 tgcaataaaa atgaacaaaa cggagacgaa acaaagatgc agagcctagt aggctatgtc   120
 121 gtgcttaaag acaatgaaag ggcaattctc attaccgata caaaagctcc aggaaaagaa   180
 181 gattacaatc tttctgaagg acaacttatg aacaagttta aaaataacat agtaattgta   240
 241 ggattaagtg agattgataa cacagatgat ctcaaaagag gtgaaaaaat aaaagtgtgg   300
 301 ttccatacac gaaaagagtc aaatccacca agtgcaacga tacaaaaata tgaattatta   360
 361 taa   363
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2049160 2049522 -1 Glimmer3 score 4.41 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu