LOADING...
   NP_389652.1;SP17457A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_389652.1    SP17457A            JCSG 418961 PDB Deposition 12-OCT-05              PDB id: 4hfs

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_389652.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacillus subtilis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4HFS; Identical; 05-DEC-12; UNCHARACTERIZED PROTEIN YNCM;
DR FFAS; 406683; Fold and function assignment.
DR TVPC; NP_389652.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_389652.1; Ortholog view popup.
DR TPM; NP_389652.1; Target PDB monitor.
DR FSS; NP_389652.1; Target function coverage.
PROPERTY Residues: 250 aa
Molecule Weight: 26595.84 Dalton
Isoelectric Point: 9.61
Extinction Coefficient: 31400
Gravy Index: -.16
Number of Met residues: 4
Percentage of Met residues: 1.60 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 250 aa
>NP_389652.1  gi|16078832|ref|NP_389652.1| yncM [Bacillus subtilis]
MAKPLSKGGILVKKVLIAGAVGTAVLFGTLSSGIPGLPAADAQVAKAASELPNGIGGRVY
LNSTGAVFTAKIVLPETVKNNDSVSTPYIYSGFRATSGTEADIGLQYSKQYNVWKPLMKV
GSKNEETYIEGKDKFTYNKGFRPGSTVQMTIYKNLSGNTRMTLWGTNNDGYTGRIITEIQ
GTNIGTISKWKTLATAAVSYESQRDAIKATFSTSFNNITIDNKAVTPVVDTQDFAKVSVA
GNNVTISVNK

CDS  cDNA 753 bp
   1 atggcgaaac cactatcaaa agggggaatt ttggtgaaaa aagtattgat tgcaggtgca    60
  61 gtaggaacag cagttctttt cggaaccctt tcatcaggta taccaggttt acccgcggca   120
 121 gacgctcaag tcgcaaaagc agcatccgag ctgcctaacg gaatcggcgg ccgtgtctac   180
 181 ctgaacagta cgggcgccgt ttttacagct aaaatcgtgc ttcctgaaac tgtcaaaaac   240
 241 aacgactcgg tctctactcc ctatatttat tctggcttta gggcaacaag cggaactgaa   300
 301 gccgatatcg ggcttcagta cagcaaacaa tacaacgtct ggaagcccct catgaaggtt   360
 361 gggtccaaaa atgaagaaac gtacatcgaa ggaaaagaca aattcacata caataaaggc   420
 421 ttccgccctg gaagcacagt ccaaatgaca atctataaaa atttaagcgg caatacgcgc   480
 481 atgacccttt ggggaacgaa caatgacggc tacaccggac ggattatcac agaaattcaa   540
 541 ggaaccaaca tcggcacgat ttcaaaatgg aaaacacttg ctaccgcggc tgtttcgtat   600
 601 gaaagccagc gtgatgcgat caaagcaacc ttttcgacct cttttaacaa catcactatc   660
 661 gacaataaag ccgtcactcc tgtggtagat acacaggatt tcgcaaaggt ttcagttgca   720
 721 ggaaataacg ttacgatctc tgttaataaa taa   753
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1902720 1903472 -3 Glimmer3 score - -
Genemark probabilities .78   .16 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu