LOADING...
   NP_389097.1;SP17473A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_389097.1    SP17473A            JCSG 418974 PDB Deposition 15-FEB-26              PDB id: 4ygt

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_389097.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacillus subtilis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4YGT; Identical; 18-MAR-15; UNCHARACTERIZED PROTEIN YJGB;
DR FFAS; 406699; Fold and function assignment.
DR TVPC; NP_389097.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_389097.1; Ortholog view popup.
DR TPM; NP_389097.1; Target PDB monitor.
DR FSS; NP_389097.1; Target function coverage.
PROPERTY Residues: 191 aa
Molecule Weight: 20806.24 Dalton
Isoelectric Point: 6.19
Extinction Coefficient: 18910
Gravy Index: -.42
Number of Met residues: 5
Percentage of Met residues: 2.62 %
Number of Cys residues: 1
Percentage of Cys residues: 0.52 %
SEQUENCE  amino acids 191 aa
>NP_389097.1  gi|16078280|ref|NP_389097.1| yjgB [Bacillus subtilis]
MKKTMSAITAAAAVTSCFTGFGAASFSAPAKAAAQTNTLSENTNQSAAELVKNLYNTAYK
GEMPQQAQGLTINKSTKGDVHAAFGEPERPVGGDNRFDLYHWNMGQPGYGFSYHKDMTIS
EIRYFGTGVERQLNLGGVTPEVLQKQLGPVNRVLTVPFTDEIDYVYDTGRYELHFVIGTD
QTADHVNLKAK

CDS  cDNA 576 bp
   1 atgaaaaaga caatgtctgc tataaccgcg gcagcagcag taacaagctg ttttaccggc    60
  61 tttggggctg cgtccttttc agcaccggca aaggccgcag ctcaaacaaa cacactctca   120
 121 gaaaacacga atcaatcagc cgctgagctt gtcaaaaacc tctataacac cgcctataaa   180
 181 ggggaaatgc ctcagcaggc gcaaggcctt accattaaca aaagcacaaa aggggatgtc   240
 241 cacgctgcgt ttggggaacc ggaaagacca gtcgggggag acaatcgatt tgatttatat   300
 301 cactggaata tgggacagcc gggctacgga ttttcctatc ataaagacat gacaatttca   360
 361 gaaatccgct actttggaac cggtgtggaa cggcagctga atttaggcgg agttacgccg   420
 421 gaagtgctgc agaagcaatt aggaccagta aatcgggtgt taaccgtccc gtttaccgat   480
 481 gaaatcgatt atgtatatga tacaggccgc tatgaactcc attttgtaat aggcacggat   540
 541 cagacagccg accatgtaaa cctaaaagca aaataa   576
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1284180 1284755 -3 Glimmer3 score 10.05 poor
Genemark probabilities .82   .06 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu