LOADING...
   NP_388460.1;SP17550A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_388460.1    SP17550A            JCSG 416512 PDB Deposition 13-AUG-23              PDB id: 4mdw

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_388460.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacillus subtilis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07563; DUF1541;
DR PDB; 4MDW; Identical; 02-OCT-13; UNCHARACTERIZED PROTEIN YDHK;
DR PDB; 2KY9; Identical; 21-JUL-10; UNCHARACTERIZED PROTEIN YDHK;
DR PDB; 4FIB; Identical; 20-JUN-12; UNCHARACTERIZED PROTEIN YDHK;
DR FFAS; 406619; Fold and function assignment.
DR TVPC; NP_388460.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_388460.1; Ortholog view popup.
DR TPM; NP_388460.1; Target PDB monitor.
DR FSS; NP_388460.1; Target function coverage.
PROPERTY Residues: 205 aa
Molecule Weight: 22535.21 Dalton
Isoelectric Point: 7.13
Extinction Coefficient: 22920
Gravy Index: -.74
Number of Met residues: 11
Percentage of Met residues: 5.37 %
Number of Cys residues: 1
Percentage of Cys residues: 0.49 %
SEQUENCE  amino acids 205 aa
>NP_388460.1  gi|16077646|ref|NP_388460.1| ydhK [Bacillus subtilis]
MSAGKSYRKKMKQRRMNMKISKYALGILMLSLVFVLSACGNNNSTKESTHDNHSDSSTHE
EMDHSGSADVPEGLQESKNPKYKVGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTP
TNGGQRVDHHKWVIQEEIKDAGDKTLQPGDQVILEASHMKGMKGATAEIDSAEKTTVYMV
DYTSTTSGEKVKNHKWVTEDELSAK

CDS  cDNA 618 bp
   1 ttgtctgcgg gcaaaagtta caggaaaaaa atgaagcaaa ggagaatgaa catgaaaatc    60
  61 tctaaatatg cactgggaat tctgatgtta tctctagttt ttgttttatc agcatgcggc   120
 121 aataacaaca gtacgaaaga aagcacacat gacaatcatt cagactcctc aacacatgaa   180
 181 gagatggacc attccggatc agctgacgtt ccagagggat tacaggaatc taaaaatccg   240
 241 aaatacaaag taggcagcca agtaatcatc aatacttctc atatgaaagg catgaaaggt   300
 301 gctgaagcta cggtaacagg cgcctatgat acaacggcgt atgttgtttc ttatactccg   360
 361 actaatgggg gacagcgtgt ggatcatcac aaatgggtga tccaagaaga aatcaaagat   420
 421 gccggagata aaacgttaca acccggagat caggtgattt tagaggcttc tcatatgaaa   480
 481 ggcatgaaag gagcaacagc cgagatcgat tccgcggaaa aaacaactgt atacatggtt   540
 541 gactacacat cgacaacgag cggcgaaaaa gtgaaaaacc acaaatgggt cacagaagat   600
 601 gagctttcag ctaaataa   618
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu