LOADING...
   NP_388160.1;SP17471A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_388160.1    SP17471A            JCSG 418973 PDB Deposition 14-AUG-19              PDB id: 4r4g

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_388160.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacillus subtilis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4R4G; Identical; 17-SEP-14; PUTATIVE LIPOPROTEIN YCDA;
DR FFAS; 406697; Fold and function assignment.
DR TVPC; NP_388160.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_388160.1; Ortholog view popup.
DR TPM; NP_388160.1; Target PDB monitor.
DR FSS; NP_388160.1; Target function coverage.
PROPERTY Residues: 354 aa
Molecule Weight: 39177.74 Dalton
Isoelectric Point: 4.92
Extinction Coefficient: 30830
Gravy Index: -.61
Number of Met residues: 7
Percentage of Met residues: 1.98 %
Number of Cys residues: 1
Percentage of Cys residues: 0.28 %
SEQUENCE  amino acids 354 aa
>NP_388160.1  gi|16077347|ref|NP_388160.1| ycdA [Bacillus subtilis]
MFQKKTYAVFLILLLMMFTAACSGSKTSAEKKESETEKSSDIAQVKIKDVSYTLPSKYDK
STSDDQLVLKVNVAVKNTGKDPLNVDSMDFTLYQGDTKMSDTDPEDYSEKLQGSTINADK
SVEGNLFFVVDKGKQYELNYTPESYGDKKPKSVTFKIDGKDKKILATADKLQDSAKALSA
YVDVLLFGKDNADFEKITGANKNEIVNDFNESAKDGYLSASGLSSTYADSKALDNIVNGI
KEGLSKNSSIQAKTTSISKDEAIVEATVKPVDASSLSDRIEDKVKDYYSKNSSASYEEAV
KYALQVYPEEFKKLGPASSEKTVEVKMKKNDIDQWQLDMDDYRAAELVEAFIKE

CDS  cDNA 1065 bp
   1 atgtttcaga aaaaaacgta cgctgttttc ctaattcttc tgctgatgat gtttacagct    60
  61 gcttgttccg gcagcaaaac aagcgcggag aagaaagaat cagaaacaga aaaaagctca   120
 121 gatatagctc aagtcaaaat caaggatgtc tcttacacac ttccgtctaa atatgataag   180
 181 tccacttcag atgaccagct tgtgttaaaa gtcaatgtcg cggtgaaaaa cacaggaaaa   240
 241 gacccgctga atgtagacag tatggatttc acattgtatc aaggtgatac caaaatgtct   300
 301 gacacagacc ctgaagacta tagcgaaaag cttcagggca gcacgattaa cgctgacaaa   360
 361 tccgttgaag gaaatctttt cttcgttgta gataaaggca agcaatacga gcttaactat   420
 421 acgccggaat cttacggtga taaaaagcca aaatcagtta cttttaaaat tgacggaaaa   480
 481 gacaaaaaaa tcctggcgac ggcagataag ctccaagatt ctgcaaaagc gttatcagct   540
 541 tatgttgatg tccttctttt cggcaaagat aacgccgatt tcgaaaaaat caccggcgct   600
 601 aacaaaaatg aaattgtaaa tgattttaat gaatcagcca aagacggtta tctctcagct   660
 661 tccggccttt ccagcacata tgcggacagc aaagcgcttg ataatatcgt gaacggcatt   720
 721 aaagagggat taagcaaaaa ctcttccatt caagcaaaaa cgacttcaat ctctaaagac   780
 781 gaagcaattg ttgaagccac agttaaacct gtagatgcat cttctctttc agaccgcatc   840
 841 gaagacaaag tgaaagacta ctacagtaaa aactctagtg ccagctatga agaggcagtg   900
 901 aaatacgcgc ttcaagtcta tcctgaggaa ttcaaaaagc ttggacctgc ttcatctgaa   960
 961 aaaacagttg aagtgaaaat gaagaaaaat gacatcgacc aatggcagct tgatatggat  1020
1021 gattacagag cagcagaatt agtcgaagca ttcatcaaag aataa  1065
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
298990 300054 -1 Glimmer3 score 11.41 poor
Genemark probabilities .89   .08 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu