LOADING...
   NP_372339.1;SP18371B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_372339.1    SP18371B            JCSG 417470 PDB Deposition 14-JUN-18              PDB id: 2mqb

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_372339.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMStaphylococcus aureus mu50
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MQB; Identical; 03-SEP-14; PROBABLE BETA-LACTAMASE;
DR FFAS; 413691; Fold and function assignment.
DR TVPC; NP_372339.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_372339.1; Ortholog view popup.
DR TPM; NP_372339.1; Target PDB monitor.
DR FSS; NP_372339.1; Target function coverage.
PROPERTY Residues: 193 aa
Molecule Weight: 20875.2 Dalton
Isoelectric Point: 8.47
Extinction Coefficient: 16960
Gravy Index: -.56
Number of Met residues: 2
Percentage of Met residues: 1.04 %
Number of Cys residues: 1
Percentage of Cys residues: 0.52 %
SEQUENCE  amino acids 193 aa
>NP_372339.1  gi|15924805|ref|NP_372339.1| probable beta-lactamase [Staphylococcus aureus subsp. aureus Mu50]
MNTKFLGKTLVASALVLTTLGTGLHSSYLGLNTNKVVKTAKAEEKMTNGQLWKKVKDSLI
DSNIISGNENEEITVTYVNKTGYSSSVSAYGNNNDDFSSTPSNFSKLKEIDLKKDNVPSD
DFNTTVSGEDSWKTLTSKLKEKGLVTDGQTVTIHCNDKSDNTKSSVSGKVGADLTSGNGT
TFKKRFIDKITID

CDS  cDNA 582 bp
   1 atgaatacaa aatttttagg taaaacatta gtagcaagtg ctttagtatt aacaacatta    60
  61 ggaacaggtt tacattcttc atacttagga ttaaatacaa ataaagttgt taaaacagca   120
 121 aaagcagaag aaaaaatgac aaatggtcaa ttgtggaaaa aagttaaaga ttcattaatt   180
 181 gattcaaata ttattagtgg taacgaaaat gaagagatta cagtaacata tgttaataaa   240
 241 accggatatt cttcaagtgt ttctgcctat ggtaataata atgacgattt ttcaagtact   300
 301 ccaagtaatt tttctaaact taaggaaatt gacttgaaaa aagataatgt accgtcagat   360
 361 gattttaata ctactgttag tggtgaagat agttggaaaa cacttacatc taaattaaag   420
 421 gaaaaaggtt tggttacaga tggacaaaca gtaactattc attgtaatga taagtctgac   480
 481 aatacaaaat catctgtttc aggtaaagta ggagcagatc tgacaagtgg caatggaact   540
 541 acattcaaaa aacgctttat tgataaaatc acaattgatt aa   582
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1943873 1944454 2 Glimmer3 score 9.04 poor
Genemark probabilities .88   .89 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu