LOADING...
   NP_372322.1;SP18390A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_372322.1    SP18390A            JCSG 417490 PDB Deposition 13-JUL-19              PDB id: 4lqz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_372322.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMStaphylococcus aureus mu50
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4LQZ; Identical; 07-AUG-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 413726; Fold and function assignment.
DR TVPC; NP_372322.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_372322.1; Ortholog view popup.
DR TPM; NP_372322.1; Target PDB monitor.
DR FSS; NP_372322.1; Target function coverage.
PROPERTY Residues: 160 aa
Molecule Weight: 18749.91 Dalton
Isoelectric Point: 9.11
Extinction Coefficient: 20400
Gravy Index: -.34
Number of Met residues: 6
Percentage of Met residues: 3.75 %
Number of Cys residues: 3
Percentage of Cys residues: 1.88 %
SEQUENCE  amino acids 160 aa
>NP_372322.1  gi|15924788|ref|NP_372322.1| hypothetical protein SAV1798 [Staphylococcus aureus subsp. aureus Mu50]
MKKFLKFKGMKICLMLYLLIFLSSCGTNNKIVGQRFEIQQHNETIGSIYFSADYAHIRGI
EKGTAKYFIDKVGSKRYLFIEYIPDNVLNCKPDFWKTLKYKKDKVTYYVYLIENLDDEVF
HLSALQDMNRIPIDIADDVATMGKSPHQNDRMTLKLNKNN

CDS  cDNA 483 bp
   1 ttgaaaaagt ttttaaaatt caaggggatg aaaatatgtt taatgctata tctactgatt    60
  61 tttttaagta gttgtggcac aaataataaa atagtaggcc aacgatttga aatacaacaa   120
 121 cataatgaaa caataggtag tatttacttt tcagcagact atgcacatat aagaggtata   180
 181 gaaaaaggca ctgcaaaata tttcatagac aaagtaggca gcaaacgtta cttatttatt   240
 241 gaatatattc cggataatgt attgaattgc aagccggact tttggaaaac gttaaaatat   300
 301 aaaaaggaca aggtaacata ttatgtatat ctcattgaaa atttagatga tgaagtattc   360
 361 catttaagtg cattacaaga catgaatcgt ataccaattg acattgcaga tgatgtggca   420
 421 acaatgggta aatcaccaca tcaaaatgac agaatgacac taaaattaaa taaaaataac   480
 481 tga   483
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1928733 1929215 -3 Glimmer3 score 5.24 poor
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu