LOADING...
   NP_372010.1;SP17984B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_372010.1    SP17984B            JCSG 421044 PDB Deposition 14-JUN-25              PDB id: 4qpv

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_372010.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMStaphylococcus aureus mu50
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07901; DUF1672;
DR PDB; 4QPV; Identical; 20-AUG-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 413595; Fold and function assignment.
DR TVPC; NP_372010.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_372010.1; Ortholog view popup.
DR TPM; NP_372010.1; Target PDB monitor.
DR FSS; NP_372010.1; Target function coverage.
PROPERTY Residues: 318 aa
Molecule Weight: 36504.33 Dalton
Isoelectric Point: 6.64
Extinction Coefficient: 22350
Gravy Index: -.78
Number of Met residues: 7
Percentage of Met residues: 2.20 %
Number of Cys residues: 2
Percentage of Cys residues: 0.63 %
SEQUENCE  amino acids 318 aa
>NP_372010.1  gi|15924476|ref|NP_372010.1| hypothetical protein SAV1486 [Staphylococcus aureus subsp. aureus Mu50]
MLKKAKLILIAVLVLSGCSTIENESKKDRNTETNTETKSVPEEMEASKYVGQGFQPPAEK
DAIEFSKKHKDKIAKRGEQFFMDNFGLKVKATNVVGSGDGVEVFVHCDDHDIVFNASIPF
DKSIIESDSSLRSEDKGDDMSTLVGTVLSGFEYRAHKEELDNLTEVLKEYKSKYKYTGYT
ENAIMKTQNSGFRNEYYYLTAIPYTLDEYKRYFQPLIKEDDKSFRDGMRNSKKQLKDKSR
PYVVTTLFSTKDNFTKDNTIDEMIDFSEVLKKKKNIPHDLNVSLQISNKYINTKRPNYSK
KEVIEVGVFNHEKANTND

CDS  cDNA 957 bp
   1 atgcttaaaa aagcaaaatt aatcttaata gcagtactag tactgtcagg gtgctccacg    60
  61 attgaaaatg aatcaaaaaa agacagaaat acagaaacaa atacagaaac gaaatctgta   120
 121 ccagaagaaa tggaagcttc aaaatatgta ggccaaggat tccaaccacc tgcagaaaaa   180
 181 gatgcgattg aattttcgaa gaagcataaa gataaaattg ctaaacgtgg cgaacaattt   240
 241 tttatggata actttggact aaaagttaaa gctacaaatg ttgtaggtag tggcgacggt   300
 301 gtagaagtat tcgtgcattg tgatgaccac gacatcgtat ttaatgcaag tattccattt   360
 361 gacaaatcaa taattgagag tgatagctca ttaagaagtg aggataaagg cgatgatatg   420
 421 agtactttag ttggtacagt gttgagtggc tttgaatatc gagcacataa ggaagagttg   480
 481 gataatttaa cagaagtttt aaaagaatat aaaagtaaat ataaatatac tggttatact   540
 541 gaaaatgcaa ttatgaaaac gcagaatagt ggttttagaa atgagtatta ttatttgact   600
 601 gcaattccat atactttaga tgaatataaa aggtattttc aacccttaat caaagaggat   660
 661 gataagtctt ttagggacgg tatgagaaac tcaaaaaaac aacttaaaga taaatcacgt   720
 721 ccatatgttg ttacaacttt atttagtact aaagataatt ttactaaaga taatacaata   780
 781 gacgagatga ttgatttttc tgaagtacta aaaaagaaaa agaatattcc tcatgatttg   840
 841 aatgtttctc ttcaaatttc taataaatat ataaatacaa aaagacctaa ctatagtaag   900
 901 aaggaagtaa tagaagtagg tgtatttaat catgaaaaag ctaacacgaa tgattaa   957
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1600550 1601506 -2 Glimmer3 score 7.51 poor
Genemark probabilities .78   .6 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu