LOADING...
   NP_370957.1;SP17980D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_370957.1    SP17980D            JCSG 417440 PDB Deposition 10-JUL-20              PDB id: 3o13

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_370957.1
DESCRIPTIONsuperantigen-like protein
ORGANISMStaphylococcus aureus mu50
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF09199; DUF1954;
DR PDB; 3O13; Identical; 25-AUG-10; SUPERANTIGEN-LIKE PROTEIN;
DR PDB; 2RDG; Highly similar; 18-DEC-07; SUPERANTIGEN-LIKE PROTEIN 11;
DR PDB; 2RDH; Highly similar; 18-DEC-07; SUPERANTIGEN-LIKE PROTEIN 11;
DR PDB; 2R61; Highly similar; 27-NOV-07; EXOTOXIN 3;
DR PDB; 1M4V; Highly similar; 17-JUL-02; SET3, SUPERANTIGEN-LIKE PROTEIN;
DR PDB; 2Z8L; Highly similar; 27-NOV-07; EXOTOXIN 3;
DR PDB; 3KLS; Highly similar; 24-NOV-09; COMPLEMENT C5;
DR PDB; 3PRX; Highly similar; 19-JAN-11; COMPLEMENT C5;
DR FFAS; 413588; Fold and function assignment.
DR TVPC; NP_370957.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_370957.1; Ortholog view popup.
DR TPM; NP_370957.1; Target PDB monitor.
DR FSS; NP_370957.1; Target function coverage.
PROPERTY Residues: 227 aa
Molecule Weight: 25438.46 Dalton
Isoelectric Point: 8.79
Extinction Coefficient: 14900
Gravy Index: -.61
Number of Met residues: 4
Percentage of Met residues: 1.76 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 227 aa
>NP_370957.1  gi|15923423|ref|NP_370957.1| exotoxin 15 [Staphylococcus aureus subsp. aureus Mu50]
MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYKGRGFELTNVTGY
KYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREGSDKSAITTSIGGITKT
NGTQHKDTVQNVNLSVSKSTGQHTTSVTSEYYSIYKEEISLKELDFKLRKHLIDKHDLYK
TEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL

CDS  cDNA 684 bp
   1 atgaaattaa aaaatattgc taaagcaagt ttagcactag ggattttaac aacaggtatg    60
  61 attacaacta ctgctcagcc agtaaaagca agtacattag aggttagatc acaagctact   120
 121 caagacttga gtgaatatta taaagggaga ggatttgaat taacaaatgt aacaggatat   180
 181 aaatacggaa ataaagttac atttatagat aattctcaac aaattgatgt tacattgaca   240
 241 ggaaatgaaa aattaactgt taaagatgat gacgaagttt ctaatgttga cgtgtttgta   300
 301 gtaagagaag gtagtgacaa atcagctatc acaacatcga ttggtggaat tacaaagaca   360
 361 aatgggactc aacataaaga tactgttcaa aacgttaatt tgtcagtttc taagagtaca   420
 421 ggtcaacaca ctacttctgt gacttcagaa tactatagca tctataaaga agaaatctca   480
 481 ttaaaagaac ttgattttaa attaagaaag catttaattg ataaacatga tctttataag   540
 541 acagaaccta aagacagtaa aattagaatt actatgaaaa acggtggcta ttatacattt   600
 601 gaattaaata aaaaattaca gcctcatcgc atgggtgata cgattgatag tagaaatata   660
 661 gagaaaattg aagtgaattt ataa   684
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
478659 479342 3 Glimmer3 score 8.3 poor
Genemark probabilities .9   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu