LOADING...
   NP_370946.1;SP17980C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_370946.1    SP17980C            JCSG 419543 PDB Deposition 15-MAY-22              PDB id: 4zys

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_370946.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMStaphylococcus aureus mu50
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF09199; DUF1954;
DR PDB; 4O1N; Highly similar; 24-DEC-14; SUPERANTIGEN-LIKE PROTEIN;
DR PDB; 4RH6; Highly similar; 29-OCT-14; EXOTOXIN 3, PUTATIVE;
DR PDB; 2RDG; Highly similar; 18-DEC-07; SUPERANTIGEN-LIKE PROTEIN 11;
DR PDB; 2RDH; Highly similar; 18-DEC-07; SUPERANTIGEN-LIKE PROTEIN 11;
DR PDB; 3O13; Highly similar; 25-AUG-10; SUPERANTIGEN-LIKE PROTEIN;
DR PDB; 2R61; Highly similar; 27-NOV-07; EXOTOXIN 3;
DR PDB; 1M4V; Highly similar; 17-JUL-02; SET3, SUPERANTIGEN-LIKE PROTEIN;
DR PDB; 2Z8L; Highly similar; 27-NOV-07; EXOTOXIN 3;
DR FFAS; 413587; Fold and function assignment.
DR TVPC; NP_370946.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_370946.1; Ortholog view popup.
DR TPM; NP_370946.1; Target PDB monitor.
DR FSS; NP_370946.1; Target function coverage.
PROPERTY Residues: 226 aa
Molecule Weight: 25688.95 Dalton
Isoelectric Point: 9.05
Extinction Coefficient: 17880
Gravy Index: -.71
Number of Met residues: 5
Percentage of Met residues: 2.21 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 226 aa
>NP_370946.1  gi|15923412|ref|NP_370946.1| exotoxin 6 [Staphylococcus aureus subsp. aureus Mu50]
MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPVLERKNVTGYK
YTEKGKDYIDVIVDNQYSQISLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVT
KTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLKELDYRLRERAIKQHGLYSNG
LKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK

CDS  cDNA 681 bp
   1 atgaaattta aagcgatagc aaaagcaagt ttagcattgg gaatgttagc aacaggtgta    60
  61 attacatcga atgtacaatc agtacaagcg aaaacagaag ttaaacaaca aagtgaatca   120
 121 gagttgaaac actattataa taaaccggtt ttagagcgta aaaatgttac tggatataaa   180
 181 tatactgaaa aaggtaaaga ttatatagat gttatagtag acaatcaata ttctcaaatt   240
 241 tctttagttg gatctgataa agacaaattt aaagatggag acaactcgaa tatagatgtg   300
 301 tttatcctta gagaaggtga cagtagacaa gcaacaaatt actcaattgg tggcgtaaca   360
 361 aaaacaaaca gtcaaccttt tattgactat atacacacac caatccttga aatcaagaaa   420
 421 ggtaaagaag aaccacaaag tagtttatac caaatttata aagaagacat ctcattgaaa   480
 481 gaacttgatt atagattaag agaacgtgca atcaaacaac acggcttgta ttcaaatggt   540
 541 cttaaacaag gtcaaattac aattacaatg aaagatggca aatcacatac tatcgattta   600
 601 agtcaaaaac ttgaaaaaga acgtatgggt gattctatcg acggcagaca aatacaaaaa   660
 661 attctagtag aaatgaaata a   681
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
466860 467540 3 Glimmer3 score 8.91 poor
Genemark probabilities .93   .92 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu