LOADING...
   NP_346487.1;NP_346487.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_346487.1    CL5766A            JCSG 359637 PDB Deposition 14-SEP-03              PDB id: 2mu1, 2go7, 2msn, 2mu2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_346487.1
DESCRIPTIONgi|15901883|ref|NP_346487.1| hydrolase, haloacid dehalogenase-like family [Strep
tococcus pneumoniae TIGR4]
ORGANISMSTREPTOCOCCUS PNEUMONIAE TIGR4
COMMENT 
DR UNIPROT; Q97NG6_STRPN
DR SPTR;
DR GenBank; NP_346487
DR Pfam; PF00702; Hydrolase;
DR PDB; 2GO7; Identical; 23-MAY-06; HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY;
DR PDB; 2MSN; Identical; 24-SEP-14; HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY;
DR PDB; 2MU2; Identical; 24-SEP-14; HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY;
DR PDB; 2MU1; Identical; 01-OCT-14; HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY;
DR PDB; 2FI1; Highly similar; 07-FEB-06; HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY;
DR FFAS; 359637; Fold and function assignment.
DR TVPC; NP_346487.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_346487.1; Ortholog view popup.
DR TPM; NP_346487.1; Target PDB monitor.
DR FSS; NP_346487.1; Target function coverage.
PROPERTY Residues: 206 aa
Molecule Weight: 23489.09 Dalton
Isoelectric Point: 4.61
Extinction Coefficient: 25900
Gravy Index: -.27
Number of Met residues: 2
Percentage of Met residues: 0.97 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 206 aa
>NP_346487.1  gi|15901883|ref|NP_346487.1| hydrolase, haloacid dehalogenase-like family [Streptococcus pneumoniae 
MQKTAFIWDLDGTLLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAED
RNLDVEVLNQVRAQSLAEKNAQVVLMPGAREVLAWADESGIQQFIYTHKGNNAFTILKDL
GVESYFTEILTSQSGFVRKPSPEAATYLLDKYQLNSDNTYYIGDRTLDVEFAQNSGIQSI
NFLESTYEGNHRIQALADISRIFETK

CDS  cDNA 621 bp
   1 atgcaaaaaa cagcttttat ttgggattta gacgggactt tattggactc ttacgaagcg    60
  61 attttatcag ggattgagga gacttttgct cagttttcta ttccttatga taaggagaag   120
 121 gtgagagagt ttatcttcaa gtattcggtg caagatttgc ttgtgcgggt ggcagaagat   180
 181 agaaatctgg atgttgaggt gctaaatcag gtgcgtgccc agagtctggc tgagaagaat   240
 241 gctcaggtag ttttgatgcc aggtgcgcgt gaggtgctag cttgggcaga cgaatcagga   300
 301 attcagcagt ttatatatac tcataagggg aacaacgctt ttaccattct caaggacttg   360
 361 ggggtggaat cctattttac agagatttta accagtcaga gtggctttgt gcggaagcca   420
 421 agtccagaag cggctaccta tctgctagat aagtatcagt tgaattctga taatacttat   480
 481 tatatagggg atcggactct ggatgtggaa tttgcccaga atagtgggat tcaaagtatc   540
 541 aactttttag agtctactta tgaagggaat cacaggattc aagcgttagc agatatttcc   600
 601 cgtatttttg agactaagtg a   621
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1845833 1846453 -2 Glimmer3 score 9.24 poor
Genemark probabilities .82   .51 poor
GenemarkHMM class 1 good
1964907 1965527 -3 Glimmer3 score 9.71 poor
Genemark probabilities .84   .45 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu