LOADING...
   NP_346007.1;SP18142A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_346007.1    SP18142A            JCSG 417515 PDB Deposition 14-MAY-14              PDB id: 4qdy

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_346007.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMStreptococcus pneumoniae tigr4
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07949; YbbR;
DR PDB; 4QDY; Identical; 30-JUL-14; CONSERVED HYPOTHETICAL PROTEIN;
DR FFAS; 413776; Fold and function assignment.
DR TVPC; NP_346007.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_346007.1; Ortholog view popup.
DR TPM; NP_346007.1; Target PDB monitor.
DR FSS; NP_346007.1; Target function coverage.
PROPERTY Residues: 259 aa
Molecule Weight: 27875.98 Dalton
Isoelectric Point: 7.7
Extinction Coefficient: 8940
Gravy Index: -.15
Number of Met residues: 4
Percentage of Met residues: 1.54 %
Number of Cys residues: 1
Percentage of Cys residues: 0.39 %
SEQUENCE  amino acids 259 aa
>NP_346007.1  gi|15901403|ref|NP_346007.1| conserved hypothetical protein [Streptococcus pneumoniae TIGR4]
MKKNSLYIISSLFFACVLFVYATATNFQNSTSARQVKTETYTNTVTNVPIDIRYNSDKYF
ISGFASEVSVVLTGANRLSLASEMQESTRKFKVTADLTDAGVGTIEVPLSIEDLPNGLTA
VATPQKITVKIGKKAQKDKVKIVPEIDPSQIDSRVQIENVMVSDKEVSITSDQETLDRID
KIIAVLPTSERITGNYSGSVPLQAIDRNGVVLPAVITPFDTIMKVTTKPVAPSSSTSNSS
TSSSSETSSSTKATSSKTN

CDS  cDNA 780 bp
   1 atgaaaaaaa atagtttata tatcatatcc tcactctttt ttgcttgtgt cttatttgtc    60
  61 tatgctacgg cgacgaattt tcaaaacagt accagtgcta ggcaggtaaa aacggaaacc   120
 121 tatactaata cagtaacaaa tgtccctatt gacatacgct ataatagtga taagtatttt   180
 181 attagcggtt ttgcttcaga agtatcagtg gtcttgactg gtgcaaatcg cctatcgcta   240
 241 gctagtgaaa tgcaagaaag tacacgtaaa ttcaaggtta ctgctgacct aacagatgcc   300
 301 ggtgttggaa cgattgaagt tcctttgagc attgaagatt tacccaatgg gctgaccgct   360
 361 gtggcgactc cgcaaaaaat tacagtcaag attggtaaga aggctcagaa ggataaggta   420
 421 aagattgtac cagagattga ccctagtcaa attgatagtc gggtacaaat tgaaaatgtc   480
 481 atggtgtcag ataaagaagt gtctattacg agtgaccaag agacattgga tagaattgat   540
 541 aagattatcg ctgttttgcc aactagcgaa cgtataacag gtaattacag tggttcagta   600
 601 cctttgcagg caatcgaccg caatggtgtt gtcttaccgg cagttatcac tccgtttgat   660
 661 acaataatga aggtgactac aaaaccagta gcaccaagtt caagcacatc aaattcaagt   720
 721 acaagcagtt catcggagac atcttcgtca acgaaagcaa ctagttcaaa aacgaattaa   780
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1404855 1405634 -3 Glimmer3 score 5.5 poor
Genemark probabilities .65   - poor
GenemarkHMM class 1 good
1469409 1470188 -3 Glimmer3 score 5.68 poor
Genemark probabilities .65   - poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu