LOADING...
   NP_344732.1;SP18161A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_344732.1    SP18161A            JCSG 417539 PDB Deposition 14-OCT-01              PDB id: 2mvb

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_344732.1
DESCRIPTIONNMR structure of YehR-like protein, PF06998 family, DUF1307
ORGANISMStreptococcus pneumoniae tigr4
COMMENTThe gene coding this protein expressed exclusively downstream of SpxA protein, which was shown to be involved in stress tolerance and
virulence.
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MVB; Identical; 05-NOV-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 413821; Fold and function assignment.
DR TVPC; NP_344732.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_344732.1; Ortholog view popup.
DR TPM; NP_344732.1; Target PDB monitor.
DR FSS; NP_344732.1; Target function coverage.
PROPERTY Residues: 189 aa
Molecule Weight: 21007.99 Dalton
Isoelectric Point: 6.76
Extinction Coefficient: 4470
Gravy Index: -.43
Number of Met residues: 1
Percentage of Met residues: 0.53 %
Number of Cys residues: 1
Percentage of Cys residues: 0.53 %
SEQUENCE  amino acids 189 aa
>NP_344732.1  gi|15900128|ref|NP_344732.1| hypothetical protein [Streptococcus pneumoniae TIGR4]
MKKIVLVSLAFLFVLVGCGQKKETGPATKTEKDTLQSALPVIENAEKNTVVTKTLVLPKS
DDGSQQTQTITYKDKTFLSLAIQQKRPVSDELKTYIDQHGVEETQKALLEAEEKDKSIIE
ARKLAGFKLETKLLSATELQTTTSFDFQVLDVKKASQLEHLKNIGLENLLKNEPSKYISD
RLANGATEQ

CDS  cDNA 570 bp
   1 atgaaaaaaa tagttcttgt tagtctagct ttcctttttg tcctggttgg ttgcggacag    60
  61 aaaaaagaaa ctggaccagc tacaaaaaca gaaaaagata cgcttcagtc ggcattgcca   120
 121 gttattgaaa atgctgagaa gaatacagtt gtaactaaga ctttggtctt gcccaagtca   180
 181 gatgatggta gccagcagac acaaacaatt acttacaaag acaagacttt tttgagtcta   240
 241 gctatccaac aaaaacgtcc agtctctgat gagttgaaga cttatattga ccaacatgga   300
 301 gtggaggaaa ctcaaaaagc tcttcttgaa gcggaggaga aggataagtc tatcattgaa   360
 361 gctcgtaaat tggcaggttt caaacttgaa acaaaactat tgagcgcaac ggaacttcaa   420
 421 acaacgacta gttttgattt tcaagttctg gatgtcaaga aggcttccca gttggaacat   480
 481 ctgaagaata ttggtttgga aaatcttttg aaaaatgaac caagcaaata tatttcagat   540
 541 agattggcaa atggcgcgac agaacaatag   570
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
181358 181927 2 Glimmer3 score 10.9 poor
Genemark probabilities .83   .04 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu