LOADING...
   NP_344022.1;MH11107A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_344022.1    MH11107A            JCSG 394448 PDB Deposition 13-JUL-19              PDB id: 4lqx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_344022.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMSulfolobus solfataricus
COMMENT 
DR UNIPROT; Q97VD2_SULSO
DR SPTR; Q97VD2 (flat text); Q97VD2 (good view)
DR GenBank; NP_344022
DR Pfam; PF03070; TENA_THI-4;
DR PDB; 4LQX; Identical; 04-SEP-13; TENA/THI-4 DOMAIN-CONTAINING PROTEIN;
DR FFAS; 394448; Fold and function assignment.
DR TVPC; NP_344022.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_344022.1; Ortholog view popup.
DR TPM; NP_344022.1; Target PDB monitor.
DR FSS; NP_344022.1; Target function coverage.
PROPERTY Residues: 303 aa
Molecule Weight: 35198.82 Dalton
Isoelectric Point: 5.97
Extinction Coefficient: 49390
Gravy Index: -.33
Number of Met residues: 15
Percentage of Met residues: 4.95 %
Number of Cys residues: 2
Percentage of Cys residues: 0.66 %
SEQUENCE  amino acids 303 aa
>NP_344022.1  gi|15899417|ref|NP_344022.1| Conserved hypothetical protein [Sulfolobus solfataricus]
MPLCPSCEMKFNSWEDLAKHMDLIANTNSDKSHVMWLNRNISMKRMEVNELANALERFFS
TPNSLSMWIRTRFIERFYGDNPHPFIVAMQNPTKGVLLGYVIEHQHFLKNWVKVLSSIVF
KTDKDDVLQYELENISVEFIGYNGRPAHYELLLRMGEALGMPREKILSTQPLPSTQSAIK
TWRKIAESKTWLETMASMHSLELVADRSLVKYGAKLPYFNPEILSSDEYPQAVKDFLREG
YEADVSHAGEALEMVEKYTEEMEMKEQVQITVLKSFDAFSKYLLARLERGFEIEPSLLKR
VIK

CDS  cDNA 912 bp
   1 atgccattat gcccatcatg tgaaatgaaa tttaactcgt gggaggatct agccaagcac    60
  61 atggatttaa ttgcaaatac caatagtgac aaatctcatg taatgtggct aaataggaat   120
 121 atatctatga agagaatgga ggtcaatgaa ctagcaaacg ccttggaaag gttcttctca   180
 181 acaccaaata gcttatcgat gtggattagg actagattta tagagagatt ttatggagac   240
 241 aaccctcatc cgtttattgt agcaatgcaa aatcctacta aaggagtgtt attaggttat   300
 301 gtaattgaac atcaacattt tttgaagaat tgggttaagg tattatcatc aatagtattc   360
 361 aaaactgata aggatgacgt tctgcaatat gaactggaga atatctcagt tgagtttata   420
 421 ggatataatg gtaggccagc tcactacgag ttattattaa gaatgggaga agccttagga   480
 481 atgccgagag agaaaatatt atcaacacaa ccattgccct ctacacaatc tgctataaag   540
 541 acatggagga aaattgctga aagtaaaact tggttagaga ccatggcatc aatgcatagt   600
 601 ctcgaattag tggctgatag aagtttagtt aaatatggag ctaaattacc ctattttaat   660
 661 ccagaaatac tttcttctga tgagtatccc caagctgtta aagactttct aagagaagga   720
 721 tatgaggctg atgtttcaca tgcgggagaa gctctagaaa tggttgagaa gtacacagag   780
 781 gaaatggaaa tgaaggaaca agtgcaaatt actgttctta agtcgtttga cgctttttca   840
 841 aagtatttat tagccagatt agagagagga ttcgaaatag aaccaagttt actaaagagg   900
 901 gtgattaaat ga   912
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu