LOADING...
   NP_342759.1;FM11532A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_342759.1    FM11532A            JCSG 377813 PDB Deposition 13-SEP-21              PDB id: 4mud

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_342759.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMSulfolobus solfataricus
COMMENT 
DR UNIPROT; Q97YL0_SULSO
DR SPTR; Q97YL0 (flat text); Q97YL0 (good view)
DR GenBank; NP_342759
DR PDB; 4MUD; Identical; 09-OCT-13; RING OXYDATION COMPLEX/ PHENYLACETIC ACID DEGRADA RELATED PR;
DR FFAS; 377813; Fold and function assignment.
DR TVPC; NP_342759.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_342759.1; Ortholog view popup.
DR TPM; NP_342759.1; Target PDB monitor.
DR FSS; NP_342759.1; Target function coverage.
PROPERTY Residues: 234 aa
Molecule Weight: 27278.94 Dalton
Isoelectric Point: 5.58
Extinction Coefficient: 37930
Gravy Index: -.26
Number of Met residues: 6
Percentage of Met residues: 2.56 %
Number of Cys residues: 2
Percentage of Cys residues: 0.85 %
SEQUENCE  amino acids 234 aa
>NP_342759.1  gi|15898154|ref|NP_342759.1| Ring oxydation complex/ phenylacetic acid degradation related protein [
MQKLRSVKEVPQDLTNTLVNIIELRADFELAMVEQYSPWLVNAPTVDSRLFVAKLVSDEL
NHGWQLVRLLEEFKVKDVIERISNARLGIHKLEVSNLPLFNWEDVIAFTFLVDGAGLYQL
KILKDCSFEPLSTLASSMIKEEESHIFFSQNELRNYQNKNRMQGAINFWFPRAVEMLHMT
WSLNETHLRDLNISDLTKNDLINGYIKTTNEELKKCGYNEVNYDKALHYNVVLK

CDS  cDNA 705 bp
   1 atgcaaaaat taaggagtgt gaaggaagtt ccacaagatt taacaaatac actagtaaac    60
  61 ataatcgaac taagagctga ttttgagctt gcaatggtag agcaatattc tccatggcta   120
 121 gtaaatgccc caacggttga tagtagatta tttgtagcca aactggtttc agatgagcta   180
 181 aatcacggat ggcaactggt aagattgtta gaggagttca aagttaaaga cgtaattgag   240
 241 aggattagta atgcgaggtt gggaatccat aaattagaag tatcgaactt accattattt   300
 301 aattgggaag acgttattgc attcacattc ctagtagatg gagctgggct atatcagcta   360
 361 aaaattctta aagactgttc attcgaaccc ctatcaaccc tagcgtctag tatgattaag   420
 421 gaagaagagt ctcatatatt tttctcacaa aatgaactaa gaaattacca aaataagaat   480
 481 agaatgcaag gtgcaattaa cttctggttc cctagagcgg tagagatgtt acacatgaca   540
 541 tggtcattaa acgaaaccca tttgagagat ctgaatattt cggatctaac taaaaacgat   600
 601 ttaataaatg gttatataaa aacaactaat gaggaactga aaaaatgtgg atataatgaa   660
 661 gtaaattacg ataaggcact ccactataat gttgtactga agtaa   705
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu