LOADING...
   NP_254181.1;SP19316A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_254181.1    SP19316A            JCSG 417377 PDB Deposition 13-NOV-22              PDB id: 2mhg

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_254181.1
DESCRIPTIONNMR structure of DUF2782 family protein, PF11191
ORGANISMPseudomonas aeruginosa
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MHG; Identical; 01-JAN-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 413387; Fold and function assignment.
DR TVPC; NP_254181.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_254181.1; Ortholog view popup.
DR TPM; NP_254181.1; Target PDB monitor.
DR FSS; NP_254181.1; Target function coverage.
PROPERTY Residues: 96 aa
Molecule Weight: 10793.78 Dalton
Isoelectric Point: 5.22
Extinction Coefficient: 15470
Gravy Index: -.23
Number of Met residues: 3
Percentage of Met residues: 3.12 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 96 aa
>NP_254181.1  gi|15600687|ref|NP_254181.1| hypothetical protein [Pseudomonas aeruginosa PA01]
MRTLNRLMLAGLLAFAPLVAMAADDDAPSGEPDVTIRQEGDKTIQEYRVNGFLYAIKVVP
KHGKPYFLVRADGSDGNFIRSDQPDKLIPQWEIFSW

CDS  cDNA 291 bp
   1 atgcgtacgc tgaaccgctt gatgctcgcc ggactgctgg cgttcgcccc gctcgtcgcg    60
  61 atggcggcgg acgacgacgc gccctccggc gagcccgacg taaccatccg ccaggagggc   120
 121 gacaagacca tccaggaata ccgcgtgaat ggcttcctct acgccatcaa ggtggttccc   180
 181 aagcatggca aaccctattt cctggtccgc gccgacggca gcgatggcaa cttcattcgc   240
 241 tccgaccagc cggacaagct gattccacaa tgggagatct tcagctggtg a   291
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
6186603 6186893 3 Glimmer3 score 14.24 good
Genemark probabilities .76   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu