LOADING...
   NP_253659.1;SP19119A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_253659.1    SP19119A            JCSG 417344 PDB Deposition 12-MAR-16              PDB id: 4e72

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_253659.1
DESCRIPTIONDUF3298 family protein, PF11738
ORGANISMPseudomonas aeruginosa
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4E72; Identical; 25-APR-12; UNCHARACTERIZED PROTEIN;
DR FFAS; 413327; Fold and function assignment.
DR TVPC; NP_253659.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_253659.1; Ortholog view popup.
DR TPM; NP_253659.1; Target PDB monitor.
DR FSS; NP_253659.1; Target function coverage.
PROPERTY Residues: 248 aa
Molecule Weight: 27852.42 Dalton
Isoelectric Point: 5.98
Extinction Coefficient: 35410
Gravy Index: -.3
Number of Met residues: 4
Percentage of Met residues: 1.61 %
Number of Cys residues: 3
Percentage of Cys residues: 1.21 %
SEQUENCE  amino acids 248 aa
>NP_253659.1  gi|15600165|ref|NP_253659.1| hypothetical protein [Pseudomonas aeruginosa PA01]
MRLLKFAALGSLVVLLSACQSLFKPGLDDPLPTERLASEHLKPGCQGEQCPLVNIDTLKF
PDEPQLDPIVERALLEMTRENNETPLPASLAAYERQFLDSAEPGWSSYLQAKVREQHDGL
VIIELSSYLFTGGAHGMPGRGFINYDRRQHKVLSLQDMLVPGQEEAFWKQAELAHKAWLL
ANKLDQDADFQKTWPFQRTPHVALTFGAVTLKYDAYSIAPYSYAHPELKIPYPRLNGIVK
PNLFPGRG

CDS  cDNA 747 bp
   1 atgcgccttc tgaaattcgc cgccctcggc agcctggtcg ttctgctgag cgcctgccag    60
  61 agcctcttca agcccggcct cgacgacccg ctgcccaccg agcgcctcgc cagcgagcac   120
 121 ctgaagcccg gctgtcaggg cgaacagtgt cccttggtaa acatcgacac cttgaagttc   180
 181 cccgacgaac cgcagttgga cccgatcgtc gagcgcgccc tgctggaaat gacccgggaa   240
 241 aacaacgaaa cgcccctgcc ggcatcgctg gcggcctacg agcggcagtt cctggacagc   300
 301 gccgagccgg gctggagcag ctacctgcaa gccaaggtgc gcgaacaaca tgacggtctg   360
 361 gtgatcatcg agctttccag ctacctgttc accggcggcg cccacggcat gcccggtcgc   420
 421 ggcttcatca actacgaccg caggcagcac aaggtgctga gcctgcagga catgctggtt   480
 481 cccggccagg aagaagcctt ctggaaacag gccgagctgg cgcacaaggc ctggctgctg   540
 541 gccaacaagc tcgaccagga cgccgatttc cagaagacct ggccgttcca gcgcaccccg   600
 601 cacgtggcat tgaccttcgg cgcggtgacg ctgaagtacg acgcctactc catcgcgccg   660
 661 tattcctatg cccaccccga actgaagatc ccgtatccgc gcctgaacgg catcgtcaag   720
 721 ccgaacctgt tccccggccg cggctga   747
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
5580962 5581708 2 Glimmer3 score 18.13 good
Genemark probabilities .9   .76 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu