LOADING...
   NP_252993.1;CP20739C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_252993.1    CP20739C            JCSG 423131 PDB Deposition 13-JUN-24              PDB id: 4lda

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_252993.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMPseudomonas aeruginosa
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4LDA; Identical; 24-JUL-13; TADZ;
DR FFAS; 423128; Fold and function assignment.
DR TVPC; NP_252993.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_252993.1; Ortholog view popup.
DR TPM; NP_252993.1; Target PDB monitor.
DR FSS; NP_252993.1; Target function coverage.
PROPERTY Residues: 394 aa
Molecule Weight: 42441.62 Dalton
Isoelectric Point: 6.87
Extinction Coefficient: 20970
Gravy Index: .18
Number of Met residues: 5
Percentage of Met residues: 1.27 %
Number of Cys residues: 2
Percentage of Cys residues: 0.51 %
SEQUENCE  amino acids 394 aa
>NP_252993.1  gi|15599499|ref|NP_252993.1| hypothetical protein [Pseudomonas aeruginosa PA01]
MNQNFVALTQHPGELDWLQNSLASAGQVVPAGSASLEELLALLDVTAAGVLFISLGKSNL
VSQGALVEGLVSARPMLSVVAIGDGLDNQLVLAAMRAGARDFITYGARASELTGLIRRLG
GRLPSVPVSAARQGELLTLVSARPDADGAFVALHLAKALQEQTPNQVLLLDVGQPTGEAL
AILGLDSAFTFSDALRNLRRLDQTLIDSAFTRLDSGLRILSLTDEPGVLERVTTAELYLL
LGNLRGAFSHVVVNLTGLPEGELSNQLLVQANRVLWMVDQSVPSCKKGLERLRRLRERNL
PLPSIELLIERYLPNVAPDQQALSRMFDLDLFGVLPLSPESRLRAKNLGKSLFEVAPRDP
LAAKLRQLADSLCVTRGERRSLLSWLGRAKAALL

CDS  cDNA 1185 bp
   1 atgaaccaga acttcgtggc gctgacccag catcccggcg aactcgactg gttgcagaac    60
  61 agcctggcgt ccgccggcca ggtggttccg gcaggcagcg ccagcctgga ggagctgctg   120
 121 gcgctgctcg acgtcaccgc cgccggggtg ctgttcatca gcctcggcaa aagcaacctg   180
 181 gtgtcccagg gcgcgctggt cgagggattg gtatcggcgc ggccgatgct ctcggtggtg   240
 241 gccatcggcg acggcctgga caaccagttg gtgctggcgg cgatgcgcgc cggcgcgcgc   300
 301 gacttcatca cctacggcgc ccgcgccagc gagctgaccg ggctgatccg gcgcctcggc   360
 361 ggacgcctgc ccagcgtgcc ggtgagcgcg gcgcgccagg gcgagctgct gaccctggtc   420
 421 agcgcccgac cggacgccga cggcgccttc gtcgccttgc acctggccaa ggcgttgcag   480
 481 gagcagacgc cgaaccaggt cctgctgctg gacgtcggcc agcccaccgg cgaggcgctg   540
 541 gcgatcctcg gcctggactc ggccttcacc ttcagcgatg ccttgcgcaa cctgcggcgc   600
 601 ctcgaccaga ccctgatcga cagcgccttc acccgcctcg acagcggcct gcggatactc   660
 661 agcctgaccg acgagcccgg cgtgctggag cgagtcacca ccgccgaact ctatctgttg   720
 721 ctgggcaacc tgcgcggggc gttcagccat gtggtggtca acctcaccgg gctgcccgag   780
 781 ggcgagctga gcaaccagtt gctggtgcag gccaaccgcg tgctgtggat ggtcgaccag   840
 841 agcgtgccgt cctgcaagaa gggcctggag cgcctgcgcc gcctgcgcga gcgcaacctg   900
 901 ccgttgccct ccatcgagtt gctgatcgag cgctacctgc ccaatgtggc gccggaccag   960
 961 caggccctga gccggatgtt cgacctcgat ctgttcggtg tcctgccgtt gtccccggaa  1020
1021 tcgcgcctgc gcgcgaagaa cctcggcaag agcctgttcg aggtggcgcc gcgcgaccca  1080
1081 ttggcggcta agctgcggca actggcggac agcctgtgcg tgacacgcgg cgagcgccgt  1140
1141 tcgctgctgt cctggctcgg ccgggccaag gcggcgctgc tatga  1185
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4827185 4828369 -2 Glimmer3 score 20.87 good
Genemark probabilities .98   .79 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu