LOADING...
   NP_252591.1;SP18816B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_252591.1    SP18816B            JCSG 420291 PDB Deposition 14-MAR-06              PDB id: 4ps6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_252591.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMPseudomonas aeruginosa
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF08816; Ivy;
DR PDB; 1UUZ; Identical; 14-JAN-04; INHIBITOR OF VERTEBRATE LYSOZYME;
DR PDB; 4PS6; Identical; 16-APR-14; INHIBITOR OF VERTEBRATE LYSOZYME;
DR FFAS; 413099; Fold and function assignment.
DR TVPC; NP_252591.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_252591.1; Ortholog view popup.
DR TPM; NP_252591.1; Target PDB monitor.
DR FSS; NP_252591.1; Target function coverage.
PROPERTY Residues: 153 aa
Molecule Weight: 16904.22 Dalton
Isoelectric Point: 6.29
Extinction Coefficient: 36440
Gravy Index: -.48
Number of Met residues: 4
Percentage of Met residues: 2.61 %
Number of Cys residues: 2
Percentage of Cys residues: 1.31 %
SEQUENCE  amino acids 153 aa
>NP_252591.1  gi|15599097|ref|NP_252591.1| hypothetical protein [Pseudomonas aeruginosa PA01]
MNGVSRLLSLALLGAALHWAPAQAEEQPRLFELLGQPGYKATWHAMFKGESDVPKWVSDA
SGPSSPSTSLSLEGQPYVLANSCKPHDCGNNRLLVAFRGDKSAAYGLQVSLPDEPAEVMQ
TPSKYATYRWYGEPSRQVRELLMKQLESDPNWK

CDS  cDNA 462 bp
   1 atgaacggag tatccagact gctctccctg gcgttgctgg gcgcggcgct gcactgggcg    60
  61 ccggcgcagg ccgaggagca gccgcggctg ttcgaactgc tcggccagcc cggctacaag   120
 121 gccacctggc atgccatgtt caagggcgag agcgacgtgc cgaaatgggt ttccgacgcc   180
 181 agcggcccga gttccccgtc caccagcctg agcctggagg gccagcccta cgtcctggcc   240
 241 aacagttgca aaccccacga ttgcggcaac aaccgcctgc tggtggcgtt ccgcggcgac   300
 301 aagagtgccg cctacgggct gcaggtgagc ctgccggacg agcccgccga agtcatgcag   360
 361 acgccgagca agtacgccac ctatcgctgg tacggcgaac cctccaggca ggtccgcgag   420
 421 ctgctgatga aacagttgga gagcgatccg aactggaagt ga   462
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4371287 4371748 -2 Glimmer3 score 15.45 good
Genemark probabilities .87   .3 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu