LOADING...
   NP_251743.1;SP16046A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_251743.1    SP16046A            JCSG 419247 PDB Deposition 12-MAY-04              PDB id: 4f0j

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_251743.1
DESCRIPTIONProbable hydrolytic enzyme, alpha/beta hydrolase fold
ORGANISMPseudomonas aeruginosa
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00561; Abhydrolase_1;
DR PDB; 4F0J; Identical; 04-JUL-12; PROBABLE HYDROLYTIC ENZYME;
DR FFAS; 413214; Fold and function assignment.
DR TVPC; NP_251743.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_251743.1; Ortholog view popup.
DR TPM; NP_251743.1; Target PDB monitor.
DR FSS; NP_251743.1; Target function coverage.
PROPERTY Residues: 335 aa
Molecule Weight: 37482.9 Dalton
Isoelectric Point: 7.68
Extinction Coefficient: 65320
Gravy Index: -.23
Number of Met residues: 9
Percentage of Met residues: 2.69 %
Number of Cys residues: 4
Percentage of Cys residues: 1.19 %
SEQUENCE  amino acids 335 aa
>NP_251743.1  gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
MSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQGQPLSMAYLDVA
PKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVDQVGFCKSSKPAHYQYSFQQL
AANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVNPIGLEDWKALGVPW
RSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSAL
TYDMIFTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRI
PQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP

CDS  cDNA 1008 bp
   1 atgtccctac cccgcctcag cctcagcctc tgtctcgccc tcgcctgcgg gccggcgctg    60
  61 gccagccagg cgccggtcta cggcgaacgc ctggaaggct tcgactacgc ctatccggtg   120
 121 cattatctgg acttcacctc ccagggccag ccgctgagca tggcctacct cgacgtcgcg   180
 181 ccgaagaaag ccaacggccg caccatcctg ctcatgcacg gcaagaattt ctgcgccggg   240
 241 acctgggagc gcaccatcga cgtgctcgcc gacgccggct accgggtgat cgccgtcgac   300
 301 caggtcggtt tctgcaagtc gagcaagccg gcccattacc agtacagctt ccagcaactg   360
 361 gcagccaaca cccacgccct gctggaacgg ctcggcgtcg cccgggccag cgtgatcggc   420
 421 cactccatgg gcggcatgct cgctacccgc tacgccctgc tctatccgcg gcaggtcgaa   480
 481 cgactggtgc tggtcaaccc catcggtctg gaggactgga aggccctggg cgtgccctgg   540
 541 cgcagcgtcg acgactggta caggcgcgac ttgcagacca gcgccgaagg cattcgccaa   600
 601 taccagcaag ccacctacta cgccggcgaa tggcgccccg agttcgatcg ctgggtacag   660
 661 atgcaggccg gcatgtatcg cggcaagggg cgcgagtcgg tggcctggaa ctcggcgctg   720
 721 acctacgaca tgatcttcac ccagccggtg gtctacgaac tggaccggtt gcagatgccg   780
 781 accctgctgc tgatcggcga gaaagacaac accgccatcg gcaaggacgc cgcgccggca   840
 841 gaactgaaag ccaggctggg caactacgcg caactgggca aggacgccgc cagacggatt   900
 901 ccccaggcga ccctggtgga attccccgac cttggccata ccccgcagat acaggctccg   960
 961 gaacgcttcc accaggcact gctggagggt ctgcaaaccc agccctga  1008
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3417113 3418120 2 Glimmer3 score 17.57 good
Genemark probabilities .92   .29 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu