LOADING...
   NP_249596.1;9946807
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_249596.1    TB0251L            JCSG 357779 PDB Deposition 04-NOV-24              PDB id: 1vpz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_249596.1
DESCRIPTIONCarbon storage regulator homolog.
ORGANISMPseudomonas aeruginosa
COMMENT-!- FUNCTION: Could accelerate the degradation of some genes
transcripts potentially through selective RNA binding (By
similarity).
-!- SIMILARITY: Belongs to the csrA family.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; CSRA_PSEAE
DR SPTR; O69078 (flat text); O69078 (good view)
DR GenBank; NP_249596
DR Pfam; PF02599; CsrA;
DR PDB; 1VPZ; Identical; 14-DEC-04; CARBON STORAGE REGULATOR HOMOLOG;
DR PDB; 1Y00; Identical; 21-JUN-05; CARBON STORAGE REGULATOR;
DR PDB; 2BTI; Identical; 04-JAN-06; CARBON STORAGE REGULATOR HOMOLOG;
DR PDB; 2JPP; Highly similar; 21-AUG-07; TRANSLATIONAL REPRESSOR;
DR PDB; 2MFC; Highly similar; 26-FEB-14; CARBON STORAGE REGULATOR HOMOLOG;
DR PDB; 2MFE; Highly similar; 26-FEB-14; CARBON STORAGE REGULATOR HOMOLOG;
DR PDB; 2MFF; Highly similar; 26-FEB-14; CARBON STORAGE REGULATOR HOMOLOG;
DR PDB; 2MFG; Highly similar; 26-FEB-14; CARBON STORAGE REGULATOR HOMOLOG;
DR FFAS; 357779; Fold and function assignment.
DR TVPC; NP_249596.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_249596.1; Ortholog view popup.
DR TPM; NP_249596.1; Target PDB monitor.
DR FSS; NP_249596.1; Target function coverage.
PROPERTY Residues: 61 aa
Molecule Weight: 6908.66 Dalton
Isoelectric Point: 6.72
Extinction Coefficient: 1490
Gravy Index: -.45
Number of Met residues: 2
Percentage of Met residues: 3.28 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 61 aa
>NP_249596.1  gi|15596102|ref|NP_249596.1| carbon storage regulator [Pseudomonas aeruginosa PA01]
MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEKDQEPN
H

CDS  cDNA 186 bp
   1 atgctgattc tgactcgtcg ggtcggagag accctgatgg taggtgacga cgtcaccgtg    60
  61 acggtactgg gtgtcaaagg gaaccaggtg cgcatcggcg tcaacgcgcc gaaggaagtc   120
 121 gccgtacacc gggaggaaat ttaccagcgc atccagaaag agaaagatca agagccaaac   180
 181 cattaa   186
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
991013 991198 2 Glimmer3 score 6.44 poor
Genemark probabilities -   - -
GenemarkHMM class 2 poor

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu