LOADING...
   NP_110623.1;FR14695A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_110623.1    FR14695A            JCSG 400673 PDB Deposition 10-APR-29              PDB id: 3mst

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_110623.1
DESCRIPTIONPutative nitrate transport protein [Phosphate binding protein-like]
ORGANISMThermoplasma volcanium
COMMENT 
DR UNIPROT; Q97CJ8_THEVO
DR SPTR; Q97CJ8 (flat text); Q97CJ8 (good view)
DR GenBank; NP_110623
DR PDB; 3MST; Identical; 09-FEB-11; PUTATIVE NITRATE TRANSPORT PROTEIN;
DR FFAS; 392498; Fold and function assignment.
DR TVPC; NP_110623.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_110623.1; Ortholog view popup.
DR TPM; NP_110623.1; Target PDB monitor.
DR FSS; NP_110623.1; Target function coverage.
PROPERTY Residues: 225 aa
Molecule Weight: 25146.53 Dalton
Isoelectric Point: 5.39
Extinction Coefficient: 16390
Gravy Index: -.14
Number of Met residues: 8
Percentage of Met residues: 3.56 %
Number of Cys residues: 3
Percentage of Cys residues: 1.33 %
SEQUENCE  amino acids 225 aa
>NP_110623.1  gi|13540935|ref|NP_110623.1| hypothetical protein TVN0104 [Thermoplasma volcanium GSS1]
MDVGMPFAGPVSFPLLVIEEELPFRIHNICSETGKFDVVLDSITNMPKYGLKIFAGVRID
MYSILGDESSGRIYTLRKGTLADFNARILAYYDKAQVINADGDTCIKMANEGYSALVGNE
ISIGKSFRNRMKELGLDLPSCAMASTRRIDEVIEAYEQGIDFIKNNHERAAEIISKKSGY
YSEEVMKKIIGIYGHEVTKKRAELVGSRELYSRVVPELNDIEIIG

CDS  cDNA 678 bp
   1 atggacgtag gcatgccatt tgcaggcccg gtttcttttc cgctacttgt gatagaagag    60
  61 gagctgccct tcaggataca caacatttgt tccgaaacgg ggaaattcga tgtcgtgttg   120
 121 gattccataa caaatatgcc aaagtatggt ttaaaaatat ttgcaggcgt aaggatagac   180
 181 atgtactcta ttcttggaga cgaatcctct ggacggatat acacacttag aaagggtact   240
 241 ctcgctgact ttaacgccag aatactggct tattacgata aggcccaggt aataaatgca   300
 301 gacggagaca cctgcataaa gatggctaat gaaggctatt cagcacttgt gggaaacgaa   360
 361 atttctatag ggaagagctt taggaatagg atgaaagaac ttggacttga cctgccttca   420
 421 tgcgccatgg cttctacgag aaggatagat gaggttattg aagcatacga acagggtata   480
 481 gattttataa aaaataacca tgaaagggct gcagagatca tatcaaaaaa atcaggatac   540
 541 tacagcgaag aggtcatgaa gaagataata ggtatctacg ggcacgaagt gactaagaaa   600
 601 agggctgaat tagtaggatc gagggaactt tattctcgcg tagtaccaga attgaatgat   660
 661 atcgaaataa tagggtga   678
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
108190 108867 -1 Glimmer3 score 9.41 poor
Genemark probabilities .84   .84 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu