LOADING...
   NP_070007.1;2649424
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_070007.1    TB2317A            JCSG 356701 PDB Deposition 14-MAY-23              PDB id: 4qgp

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_070007.1
DESCRIPTIONHypothetical protein AF1178.
ORGANISMArchaeoglobus fulgidus
COMMENT 
DR UNIPROT; O29089_ARCFU
DR SPTR; O29089 (flat text); O29089 (good view)
DR GenBank; NP_070007
DR PDB; 4QGP; Identical; 02-JUL-14; PYROPHOSPHATASE;
DR PDB; 2A3Q; Highly similar; 19-JUL-05; HYPOTHETICAL PROTEIN;
DR PDB; 2Q4P; Highly similar; 19-JUN-07; PROTEIN RS21-C6;
DR PDB; 2OIE; Highly similar; 06-MAR-07; RS21-C6;
DR PDB; 2OIG; Highly similar; 06-MAR-07; RS21-C6;
DR FFAS; 356701; Fold and function assignment.
DR TVPC; NP_070007.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_070007.1; Ortholog view popup.
DR TPM; NP_070007.1; Target PDB monitor.
DR FSS; NP_070007.1; Target function coverage.
PROPERTY Residues: 106 aa
Molecule Weight: 12753.96 Dalton
Isoelectric Point: 4.95
Extinction Coefficient: 15470
Gravy Index: -.51
Number of Met residues: 2
Percentage of Met residues: 1.89 %
Number of Cys residues: 1
Percentage of Cys residues: 0.94 %
SEQUENCE  amino acids 106 aa
>NP_070007.1  gi|11498778|ref|NP_070007.1| hypothetical protein [Archaeoglobus fulgidus DSM 4304]
MEELLDILREFRDSRGWLKYHTPKNLAVSISIEVAELLEIFQWTRSSDEEFEVLERRKGE
VEEEIADVLIYLLFLCDVAEINPIEAVKRKMEKNERKYPKNRVHEF

CDS  cDNA 321 bp
   1 atggaggagc ttttagacat tctgagggag ttcagggatt cgaggggatg gcttaaatac    60
  61 cacactccca agaatctcgc cgtttcaatc tcgattgagg ttgctgagct tcttgagatt   120
 121 ttccagtgga ctcgcagcag cgatgaggag tttgaggttc tggaaaggag aaagggcgaa   180
 181 gttgaggagg aaattgcaga cgtgctgatt tacctcctct ttctctgtga cgttgccgaa   240
 241 ataaacccga tagaggcggt gaagagaaag atggagaaga acgagaggaa gtatccgaag   300
 301 aacagagttc acgagttctg a   321
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu