LOADING...
   NP_009193.2;MA4350A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_009193.2    MA4350A.PARK7            JCSG 399795 PDB Deposition 15-APR-22              PDB id: 4zgg

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_009193.2
DESCRIPTIONCASP Target
Description Hidden
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT; PARK7_HUMAN
DR SPTR; Q99497; O14805; Q6DR95; Q7LFU2 (flat text); Q99497; O14805; Q6DR95; Q7LFU2 (good view)
DR GenBank;
DR Pfam; PF01965; DJ-1_PfpI;
DR PDB; 1P5F; Identical; 12-AUG-03; RNA-BINDING PROTEIN REGULATORY SUBUNIT;
DR PDB; 1UCF; Identical; 19-AUG-03; RNA-BINDING PROTEIN REGULATORY SUBUNIT;
DR PDB; 1Q2U; Identical; 07-OCT-03; RNA-BINDING PROTEIN REGULATORY SUBUNIT;
DR PDB; 1SOA; Identical; 22-JUN-04; RNA-BINDING PROTEIN REGULATORY SUBUNIT;
DR PDB; 2OR3; Identical; 13-FEB-07; PROTEIN DJ-1;
DR PDB; 3BWE; Identical; 14-OCT-08; PROTEIN DJ-1;
DR PDB; 4BTE; Identical; 06-NOV-13; PROTEIN DJ-1;
DR PDB; 4MNT; Identical; 05-MAR-14; PROTEIN DJ-1;
DR FFAS; 399795; Fold and function assignment.
DR TVPC; NP_009193.2; Homologs in PDB, JCSG and SG center.
DR OVP; NP_009193.2; Ortholog view popup.
DR TPM; NP_009193.2; Target PDB monitor.
DR FSS; NP_009193.2; Target function coverage.
PROPERTY Residues: 189 aa
Molecule Weight: 19889.94 Dalton
Isoelectric Point: 6.33
Extinction Coefficient: 4470
Gravy Index: .01
Number of Met residues: 5
Percentage of Met residues: 2.65 %
Number of Cys residues: 3
Percentage of Cys residues: 1.59 %
SEQUENCE  amino acids 189 aa
>NP_009193.2  NP_009193.2 DJ-1 protein [Homo sapiens]
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD

CDS  cDNA 567 bp
   1 atggcttcca aaagagctct ggtcatcctg gctaaaggag cagaggaaat ggagacggtc    60
  61 atccctgtag atgtcatgag gcgagctggg attaaggtca ccgttgcagg cctggctgga   120
 121 aaagacccag tacagtgtag ccgtgatgtg gtcatttgtc ctgatgccag ccttgaagat   180
 181 gcaaaaaaag agggaccata tgatgtggtg gttctaccag gaggtaatct gggtgcacag   240
 241 aatttatctg agtctgctgc tgtgaaggag atactgaagg agcaggaaaa ccggaagggc   300
 301 ctgatagccg ccatctgtgc aggtcctact gctctgttgg ctcatgaaat aggttttgga   360
 361 agtaaagtta caacacaccc tcttgctaaa gacaaaatga tgaatggagg tcattacacc   420
 421 tactctgaga atcgtgtgga aaaagacggc ctgattctta caagccgggg gcctgggacc   480
 481 agcttcgagt ttgcgcttgc aattgttgaa gccctgaatg gcaaggaggt ggcggctcaa   540
 541 gtgaaggctc cacttgttct taaagac   567
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu