LOADING...
   NM_184234;NM_184234
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_184234    WS20613I.RBM39            JCSG 430554 PDB Deposition 15-MAR-18

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNM_184234
DESCRIPTIONCASP Target
Description Hidden
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00076; RRM_1;
DR PDB; 4OZ0; Identical; 14-MAY-14; RNA-BINDING PROTEIN 39;
DR PDB; 4OZ1; Identical; 14-MAY-14; RNA-BINDING PROTEIN 39;
DR PDB; 2LQ5; Identical; 07-MAR-12; RNA-BINDING PROTEIN 39;
DR PDB; 3S6E; Identical; 15-JUN-11; RNA-BINDING PROTEIN 39;
DR PDB; 4J5O; Identical; 10-APR-13; RNA-BINDING PROTEIN 39;
DR PDB; 4RU2; Identical; 04-FEB-15; RNA-BINDING PROTEIN 39 (RBM39);
DR PDB; 5CXT; Identical; 14-OCT-15; RNA-BINDING PROTEIN 39;
DR PDB; 2JRS; Identical; 04-SEP-07; RNA-BINDING PROTEIN 39;
DR FFAS; 424737; Fold and function assignment.
DR TVPC; NM_184234; Homologs in PDB, JCSG and SG center.
DR OVP; NM_184234; Ortholog view popup.
DR TPM; NM_184234; Target PDB monitor.
DR FSS; NM_184234; Target function coverage.
PROPERTY Residues: 530 aa
Molecule Weight: 59376.32 Dalton
Isoelectric Point: 10.1
Extinction Coefficient: 25900
Gravy Index: -.65
Number of Met residues: 15
Percentage of Met residues: 2.83 %
Number of Cys residues: 5
Percentage of Cys residues: 0.94 %
SEQUENCE  amino acids 530 aa
>NM_184234  NM_184234 Homo sapiens RNA binding motif protein 39 (RBM39), transcript variant 1, mRNA, coding regi
MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRD
RERKKSKSRERKRSRSKERRRSRSRSRDRRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKL
SRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVR
DVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMAN
NLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD
SECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDLGTTGRLQLM
ARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQP
LATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPS
IAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR

CDS  cDNA 1593 bp
   1 atggcagacg atattgatat tgaagcaatg cttgaggctc cttacaagaa ggatgagaac    60
  61 aagttgagca gtgccaacgg ccatgaagaa cgtagcaaaa agaggaaaaa aagcaagagc   120
 121 agaagtcgta gtcatgaacg aaagagaagc aaaagtaagg aacggaagcg aagtagagac   180
 181 agagaaagga aaaagagcaa aagccgtgaa agaaagcgaa gtagaagcaa agagaggcga   240
 241 cggagccgct caagaagtcg agatcgaaga tttagaggcc gctacagaag tccttactcc   300
 301 ggaccaaaat ttaacagtgc catccgagga aagattgggt tgcctcatag catcaaatta   360
 361 agcagacgac gttcccgaag caaaagtcca ttcagaaaag acaagagccc tgtgagagaa   420
 421 cctattgata atttaactcc tgaggaaaga gatgcaagga cagtcttctg tatgcagctg   480
 481 gcggcaagaa ttcgaccaag ggatttggaa gagtttttct ctacagtagg aaaggttcga   540
 541 gatgtgagga tgatttctga cagaaattca agacgttcca aaggaattgc ttatgtggag   600
 601 ttcgtcgatg ttagctcagt gcctctagca ataggattaa ctggccaacg agttttaggc   660
 661 gtgccaatca tagtacaggc atcacaggca gaaaaaaaca gagctgcagc aatggcaaac   720
 721 aatttacaaa agggaagtgc tggacctatg aggctttatg tgggctcatt acacttcaac   780
 781 ataactgaag atatgcttcg tgggatcttt gagccttttg gaagaattga aagtatccag   840
 841 ctgatgatgg acagtgaaac tggtcgatcc aagggatatg gatttattac attttctgac   900
 901 tcagaatgtg ccaaaaaggc tttggaacaa cttaatggat ttgaactagc aggaagacca   960
 961 atgaaagttg gtcatgttac tgaacgtact gatgcttcga gtgctagttc atttttggac  1020
1021 agtgatgaac tggaaaggac tggaattgat ttgggaacaa ctggtcgtct tcagttaatg  1080
1081 gcaagacttg cagagggtac aggtttgcag attccgccag cagcacagca agctctacag  1140
1141 atgagtggct ctttggcatt tggtgctgtg gcagaattct cttttgttat agatttgcaa  1200
1201 acaagacttt cccagcagac tgaagcttca gctttagctg cagctgcctc tgttcagcca  1260
1261 cttgcaacac aatgtttcca actctctaac atgtttaacc ctcaaacaga agaagaagtt  1320
1321 ggatgggata ccgagattaa ggatgatgtg attgaagaat gtaataaaca tggaggagtt  1380
1381 attcatattt atgttgacaa aaattcagct cagggcaatg tgtatgtgaa gtgcccatca  1440
1441 attgctgcag ctattgctgc tgtcaatgca ttgcatggca ggtggtttgc tggtaaaatg  1500
1501 ataacagcag catatgtacc tcttccaact taccacaacc tgtttcctga ttctatgaca  1560
1561 gcaacacagc tactggttcc aagtagacga tga  1593
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu